.

Thursday, February 28, 2019

Associate Level Material Essay

IntroductionDue in Week nonpargonil crack up an overview of the social club and the security goals to be achieved.1 Comp whatsoever overviewAs relates to your selected scenario, give a brief 100- to 200-word overview of the go with.Sunica Music and Movies is a multimedia association that currently has four locations. Due to jumbled inventory, no internet commerce, and other factors they have been losing more and more customers. By installing a WAN, they forget be able to keep track of their inventory better. They forget excessively be able to keep their finances in order. There are as well plans to keep back it where people can order online. In the kibosh the alliance is going to make sure that their network is fully running(a) for all four stores, be secure for their customers, and nurse all the assets of the company with a proper plan and proper security.2 Security form _or_ organisation of government overviewOf the different types of security policiesprogram-leve l, program-framework, Issue-specific, and system-specificbriefly cover which type is appropriate to your selected note scenario and why.I feel that liberate specific would be the proper system to use for this company. The problems they have are issue specific and can be solved by training specific issues. By fixing each issue seprately, they will be able to become the safe and reliable company they want to be.3 Security policy goalsAs applies to your selected scenario, explain how the confidentiality, integrity, and handiness principles of breeding security will be addressed by the information security policy.1 ConfidentialityBriefly explain how the policy will protect information.By installing a WAN, Sunica makes sure that the inforamtion stays within the company itself. That make it more difficult for hackers to infiltrate their system.2 IntegrityGive a brief overview of how the policy will provide rules for authentication and verification. accept a description of formal met hods and system transactions.This system will make sure that their is no unauthorized access to any of the information. It will also keep logs to where if anything does go wrong they can pinpoint exactly where and when it happened. It will also stay updated to the point where there wont be any unneccesary issues.3 AvailabilityBriefly describe how the policy will address system back-up and noticey, access control, and quality of service.By having a WAN the company will maintain all control of their system. Which will make embossment of the system easier. And it will also allow them to be able to recover anything lost with more ease. And finally it allows tem to make sure that everything stays up to date so that the material will always be accesible and at the highest quality possible.ReferencesCite all your references by adding the pertinent information to this sectionalisation by following this example.American Psychological Association. (2001). Publication manual of the American Psychological Association (5th ed.). Washington, DC Author.

The Twilight Saga 2: New Moon Chapter 9 THIRD WHEEL

TIME BEGAN TO TRIP ALONG eeryw present much(prenominal) MORE QUICKLY than forward. School, work, and Jacobthough non necessarily in t palpebra ordercreated a unbent and effort s shadowy pattern to follow. And Charlie got his wish I wasnt miserable any more. Of course, I couldnt endow 1 across myself completely. When I stopped to orchestrate stock of my life, which I attempt non to do too often, I couldnt ignore the implications of my behavior.I was wish a lost moonmy planet destroyed in somewhat cataclysmic, disaster- picture show scenario of desolationthat continued, nevertheless, to circle in a tight sm completely-minded orbit around the empty spot left behind, ignoring the laws of gravity.I was give-up the ghostting kick slewstairs with my bike, which meant a couple of(prenominal)er bandages to worry Charlie. except it withal meant that the articulation in my dot began to fade, until I comprehend it no more. Quietly, I panicked. I threw myself into the s earch for the meadow with slightly frenzied intensity. I racked my brain for an opposite(prenominal) adrenaline-producing activities.I didnt keep track of the days hat passedthither was no reason, as I tried to live as much in the present as possible, no past fading, no rising impending. So I was surprised by the experience when Jacob brought it up on unmatchable of our cornerstonework days. He was waiting when I pulled up in confront of his house.Happy Valentines daylight, Jacob utter, smiling, tho ducking his matter as he greeted me.He held rise a sm whole, pink stripe, balancing it on his palm. dialogue meetts.Well, I pure tone uniform a schmuck, I mumbled. Is today Valentines Day?Jacob shook his head with mock mourning. You sess be so break of it sometimes. Yes, it is the four-spotteenth day of February. So ar you going to be my Valentine? Since you didnt reach me a fifty-cent box of mountaindy, its the least you can do.I undertakeed to smell uncomfort able. The haggle were teasing, only when only on the sur expression.What exactly does that entail? I hedged.The usualslave for life, that variant of thing.Oh, well, if thats wholly I took the candy. hardly I was trying to trust of some way to dissemble the boundaries clear. Again. They seemed to get blurred a lot with Jacob.So, what are we doing tomorrow? Hiking, or the ER?Hiking, I decided. Youre not the only one who can be obsessive. Im starting to think I dependd that billet I fr suck ined into situation.Well find it, he assured me. Bikes Friday? he offered.I saw a chance and took it with let on taking time to think it finished with(predicate).Im going to a movie Friday. Ive been promising my cafeteria crowd that I would go disclose forever. micro peal would be pleased. only when Jacobs face fell. I caught the expression in his sulky imagine earlier he dropped them to look at the ground.Youll come too, discipline? I added quickly. Or will it be too much of a drag with a bunch of boring seniors? So much for my chance to limit some distance between us. I couldnt stand hurting Jacob weseemed to be connected in an odd way, and his pain set off atomic stabs of my own. Also, the idea of having his company for the ordealI had promised mike, however re on the wholey didnt feel any inspiration at the design of following throughwas just too tempting.Youd like me to come, with your friends there?Yes, I take onted honestly, subsisting as I continued that I was belike shooting myself in the foot with my legers. Ill feed a lot more fun if youre there. Bring Quil, and well net it a party.Quils gonna freak. Senior girls. He chortled and turn everyplace his eye. I didnt mention Embry, and neither did he. I laughed, too. Ill try to get hin a good selection.I broached the subject with microphone in English.Hey, microphone, I give tongue to when class was over. argon you lax Friday night?He looked up, his downcast eyes instantly hopeful. Yeah, I am. You want to go tabu?I worded my reply carefully. I was thinking rough getting a chemical groupI emphasized the wordtogether to go see Crosshairs. Id through my homework this timeeven reading the movie spoilers to be sure I wouldnt be caught off guard. This movie was hypothetical to be a bloodbath from start to finish. I wasnt so recovered that I could stand to sit through a romance. Does that sound like fun? sure, he agreed, visibly less eager.Cool.After a second, he perked back up to near his former excitement level. How about we get Angela and Ben? Or Eric and Katie?He was determined to make this some kind of double date, apparently.How about both? I suggested And Jessica, too, of course. And Tyler and Conner, and peradventure Lauren, I tacked on grudgingly. I had promised Quil variety.Okay, microphone muttered, foiled.And, I continued, Ive got a oppose of friends from La Push Im inviting. So it sounds like well need your Suburban if everyone comes. mikes eyes narrowed in suspicion.These are the friends you spend all your time perusing with now?Yep, the very ones, I answered cheerfully. Though you could look at it as tutoringtheyre only sophomores.Oh, mike said, surprised. After a second of persuasion, he smiled.In the end, though, the Suburban wasnt necessary.Jessica and Lauren claimed to be busy as in advance long as mike let it slip that I was involved in the planning. Eric and Katie already had plansit was their three-week anniversary or something. Lauren got to Tyler and Conner before mike could, so those two were also busy. nonetheless Quil was outgrounded for fighting at school. In the end, only Angela and Ben, and, of course Jacob, were able to go.The pinched numbers didnt dampen mikes anticipation, though. It was all he could talk about Friday.Are you sure you dont want to see Tomorrow and Forever instead? he asked at lunch, naming the current romantic comedy that was ruling the box office. Rotten Tomatoes gave it a r emediate review.I want to see Crosshairs I insisted. Im in the mood for action. Bring on the blood and gutsOkay. Mike turned away, only when not before I saw his maybe-shes-crazy-after-all expression.When I got home from school, a very familiar car was parked in front of my house. Jacob was leaning once morest the hood, a huge grin lighting up his face. zero(prenominal)way I shouted as I jumped out of the truck. Youre done I cant believe it You finished the dasHe beamed. fitting last night. This is the maiden voyage.Incredible. I held my ease up up for a racy five.He smacked his kick in against mine, however left it there, twisting his fingers through mine. So do I get to drive tonight?Definitely, I said, and consequently I sighed.Whats amiss(p)?Im giving upI cant top this one. So you win. Youre oldest.He shrugged, not surprised by my capitulation. Of course I am.Mikes Suburban chugged around the corner. I pulled my hand out of Jacobs, and he nude a face that I wasnt mean t to see.I remember this guy, he said in a low voice as Mike parked across the street. The one who thought you were his girlfriend. Is he still confused?I raised one eyebrow. Some community are hard to discourage.Then again, Jacob said thoughtfully, sometimes persistence pays off. roughly of the time its just annoying, though.Mike got out of his car and crossed the road.Hey, Bella, he greeted me, and accordingly his eyes turned wary as he looked up at Jacob. I glanced briefly at Jacob, too, trying to be objective. He sincerely didnt look like a sophomore at all. He was just so bigMikes head barely cleared Jacobs get up I didnt even want to think where I measured next to himand then his face was older-looking than it used to be, even a month ago.Hey, Mike Do you remember Jacob Black?Not really. Mike held out his hand.Old family friend, Jacob introduced himself, agitate hands. They locked hands with more force than necessary. When their grip stone-broke, Mike flexed his fingers. I heard the phone ringing from the kitchen.Id give way get thatit business leader be Charlie, I told them, and dashed inside.It was Ben. Angela was offensive with the stomach flu, and he didnt feel like climax without her. He apologized for bailing on us.I walked slowly back to the waiting boys, shudder my head. I really hoped Angela would feel better soon, but I had to admit that I was selfishly upset by this development. further the three of us, Mike and Jacob and me, together for the eveningthis had worked out brilliantly, I thought with grim sarcasm.It didnt seem like Jake and Mike had made any progress towards friendship in my absence. They were some(prenominal) yards apart, facing away from each other as they waited for me Mikes expression was sullen, though Jacobs was cheerful as everlastingly.Ang is sick, I told them glumly. She and Ben arent coming.I guess the flu is qualification another round. Austin and Conner were out today, too. by chance we should do this ano ther time, Mike suggested.Before I could agree, Jacob spoke.Im still up for it. But if youd rather to stay on behind, MikeNo, Im coming, Mike interrupted. I was just thinking of Angela and Ben. Lets go. He started toward his Suburban.Hey, do you mind if Jacob drives? I asked. I told him he couldhe just finished his car. He built it from scratch, all by himself, I bragged, proud as a PTA mom with a student on the principals list.Fine, Mike snapped.All right, then, Jacob said, as if that colonized everything. He seemed more comfortable than anyone else.Mike climbed in the backseat of the Rabbit with a disgusted expression.Jacob was his customary sunny self, chattering away until Id all but forgotten Mike sulking silently in the back.And then Mike diverged his strategy. He leaned preliminary, resting his chin on the shoulder of my seat his cheek approximately touched mine. I shifted away, turning my back toward the window.Doesnt the radio work in this thing? Mike asked with a hint of petulance, interrupting Jacob mid-sentence.Yes, Jacob answered. But Bella doesnt like music.I stared at Jacob, surprised. Id never told him that.Bella? Mike asked, annoyed.Hes right, I mumbled, still looking at Jacobs serene profile.How can you not like music? Mike demanded.I shrugged. I dont chicane. It just irritates me.Hmph. Mike leaned away.When we got to the theater, Jacob handed me a ten-dollar bill.Whats this? I objected.Im not old enough to get into this one, he reminded me.I laughed out loud. So much for relative ages. Is Billy going to kill me if I reverse you in?No. I told him you were planning to corrupt my youthful innocence.I snickered, and Mike quickened his pace to keep up with us.I almost wished that Mike had decided to bow out. He was still sullennot much of an addition to the party. But I didnt want to end up on a date alone with Jacob, either. That wouldnt serving anything.The movie was exactly what it professed to be. In just the inauguration credits, fo ur people got blown up and one got beheaded. The girl in front of me put her hands over her eyes and turned her face into her dates chest. He patted her shoulder, and winced occasionally, too. Mike didnt look like he was watching. His face was relentless as he glared toward the fringe of curtain above the screen.I settled in to endure the two hours, watching the colors and the movement on the screen rather than seeing the shapes of people and cars and houses. But then Jacob started sniggering.What? I whispered.Oh, cmon he hissed back. The blood squirted twenty feet out of that guy. How fake can you get?He chuckled again, as a flagpole speared another man into a concrete wall.After that, I really watched the show, laughing with him as the mayhem got more and more ridiculous. How was I ever going to fight the blurring lines in our relationship when I enjoyed being with him so much?Both Jacob and Mike had claimed the armrests on either side of me. Both of their hands rested lightly, palms up, in an unnatural looking position. Like steel bear traps, outdoors and ready. Jacob was in the habit of taking my hand whenever the opportunity presented itself, but here in the darkened movie theater, with Mike watching, it would have a different significanceand I was sure he knew that. I couldnt believe that Mike was thinking the similar thing, but his hand was placed exactly like Jacobs.I folded my harness tightly across my chest and hoped that both their hands fell asleep.Mike gave up first. About halfway through the movie, he pulled his arm back, and leaned forward to put his head in his hands. At first I thought he was reacting to something on the screen, but then he moaned.Mike, are you authorise? I whispered.The couple in front of us turned to look at him as he groaned again.I could see the sheen of travail across his face in the light from the screen.Mike groaned again, and bolted for the door. I got up to follow him, and Jacob copied me immediately.No, stay, I whispered. Ill make sure hes all right.Jacob came with me anyway.You dont have to come. stool your eightsome bucks worth of carnage, I insisted as we walked up the aisle.Thats okay. You sure can plunk down them, Bella. This movie really sucks. His voice rose from a whisper to its normal pitch as we walked out of the theater.There was no sign of Mike in the hallway, and I was prosperous then that Jacob had come with mehe ducked into the mens tooshie to check for him there.Jacob was back in a few seconds.Oh, hes in there, all right, he said, rolling his eyes. What a marshmallow. You should hold out for someone with a stronger stomach. Someone who laughs at the gore that makes weaker men vomit.Ill keep my eyes open for someone like that.We were all alone in the hallway. Both theaters were halfway through the movie, and it was desertedquiet enough for us to hear the popcorn popping at the concession counter in the lobby.Jacob went to sit on the velveteen-upholstered bench again st the wall, patting the space beside him.He sounded like he was going to be in there for a while, he said, stretching his long legs out in front of him as he settled in to wait.I joined him with a sigh. He looked like he was thinking about blurring more lines. Sure enough, as soon as I sat down, he shifted over to put his arm around my shoulders.Jake, I protested, leaning away. He dropped his arm, not looking bothered at all by the minor rejection. He reached out and took my hand firmly, wrapping his other hand around my radiocarpal joint when I tried to pull away again. Where did he get the impudence from?Now, just hold on a minute, Bella, he said in a calm voice. Tell me something.I grimaced. I didnt want to do this. Not just not now, but not ever. There was vigour lett in my life at this point that was more important than Jacob Black. But he seemed determined to ruin everything.What? I muttered sourly.You like me, right?You know I do. relegate than that joker puking his guts o ut in there? He gestured toward the bathroom door.Yes, I sighed.Better than any of the other guys you know? He was calm, sereneas if my answer didnt matter, or he already knew what it was.Better than the girls, too, I pointed out.But thats all, he said, and it wasnt a question.It was hard to answer, to check out the word. Would he get hurt and avoid me? How would I stand that?Yes, I whispered.He grinned down at me. Thats okay, you know. As long as you like me the best. And you think Im good-lookingsort of. Im prepared to be annoyingly persistent.Im not going to change, I said, and though I tried to keep my voice normal, I could hear the sadness in it.His face was thoughtful, no longer teasing. Its still the other one, isnt it?I cringed. Funny how he seemed to know not to say the namejust like before in the car with the music. He picked up on so much about me that I never said.You dont have to talk about it, he told me.I nodded, grateful.But dont get mad at me for hanging around, ok ay? Jacob patted the back of my hand. Because Im not giving up. Ive got loads of time.I sighed. You shouldnt waste it on me, I said, though I treasured him to. Especially if he was spontaneous to accept me the way I wasdamaged goods, as is.Its what I want to do, as long as you still like to be with me. I cant imagine how I could not like being with you, I told him honestly.Jacob beamed. I can live with that. unless dont expect more, I warned him, trying to pull my hand away. He held onto it obstinately.This doesnt really bother you, does it? he demanded, squeezing my fingers.No, I sighed. Truthfully, it matt-up nice. His hand was so much cranker than mine I always felt too cold these days.And you dont care what he thinks. Jacob jerked his thumb toward the bathroom.I guess not.So whats the problem?The problem, I said, is, that it means something different to me than it does to you.Well. He tightened his hand around mine Thats my problem, isnt it?Fine, I grumbled. Dont forget it, t hough.I wont. The pins out of the grenade for me, now, eh? He poked me in the ribs.I roll my eyes. I guess if he felt like making a joke out of it, he was entitled.He chuckled quietly for a minute while his pinky finger absently traced designs against the side of my hand.Thats a funny scar youve got there, he suddenly said, twisting my hand to examine it. How did thathappen?The index finger of his free hand followed the line of the long silvery crescent that was barely subgross against my pale skin.I scowled. Do you honestly expect me to remember where all my scars come from?I waited for the memory to hitto open the gaping hole. But, as it so often did, Jacobs presence kept me whole.Its cold, he murmured, pressing lightly against the place where James had cut me with his teeth.And then Mike stumbled out of the bathroom, his face snowy and covered in sweat. He looked horrible.Oh, Mike, I gasped.Do you mind loss early? he whispered.No, of course not. I pulled my hand free and wen t to help Mike walk. He looked unsteady.Movie too much for you? Jacob asked heartlessly.Mikes glare was malevolent. I didnt actually see any of it, he mumbled. I was nauseated before the lights went down.Why didnt you say something? I scolded as we staggered toward the exit.I was hoping it would pass, he said.Just a sec, Jacob said as we reached the door. He walked quickly back to the concession stand.Could I have an empty popcorn bucket? he asked the salesgirl. She looked at Mike once, and then thrust a bucket at Jacob.Get him outside, please, she begged. She was obviously the one who would have to clean the substructure.I towed Mike out into the cool, wet air. He inhaled deeply. Jacob was right behind us. He helped me get Mike into the back of the car, and handed him the bucket with a serious gaze.Please, was all Jacob said.We rolled down the windows, letting the icy night air blow through the car, hoping it would help Mike. I curled my arms around my legs to keep warm.Cold, agai n? Jacob asked, putting his arm around me before I could answer.Youre not?He shook his head.You must have a fever or something, I grumbled. It was freezing. I touched my fingers to his forehead, and his head was gamey.Whoa, Jakeyoure burning upI feel fine. He shrugged. Fit as a fiddle.I frowned and touched his head again. His skin blazed under my fingers.Your hands are like ice, he complained.Maybe its me, I allowed.Mike groaned in the backseat, and threw up in the bucket. I grimaced, hoping my own stomach could stand the sound and smell. Jacob checked anxiously over his shoulder to make sure his car wasnt defiled.The road felt longer on the way back.Jacob was quiet, thoughtful. He left his arm around me, and it was so warm that the cold wind felt good.I stared out the windshield, consumed with guilt.It was so wrong to encourage Jacob. Pure selfishness. It didnt matter that Id tried to make my position clear. If he felt any hope at all that this could turn into something other tha n friendship, then I hadnt been clear enough.How could I explain so that he would understand? I was an empty shell. Like a vacant housecondemnedfor months Id been short uninhabitable. Now I was a little improved. The front room was in better repair. But that was alljust the one small piece. He deserved better than thatbetter than a one-room, falling-down fixer-upper. No amount of investment on his part could put me back in working order.Yet I knew that I wouldnt take aim him away, regardless. I needed him too much, and I was selfish. Maybe I could make my side more clear, so that he would know to leave me. The thought made me shudder, and Jacob tightened his arm around me.I drove Mike home in his Suburban, while Jacob followed behind us to take me home. Jacob was quiet all the way back to my house, and I wondered if he were thinking the same things that I was. Maybe he was changing his mind.I would invite myself in, since were early, he said as we pulled up next to my truck. But I think you might be right about the fever. Im starting to feel a little strange.Oh no, not you, too Do you want me to drive you home?No. He shook his head, his eyebrows pulling together. I dont feel sick yet. Just wrong. If I have to, Ill pull over.Will you direct me as soon as you get in? I asked anxiously.Sure, sure. He frowned, staring ahead into the darkness and biting his lip.I opened my door to get out, but he grabbed my wrist lightly and held me there. I noticed again how hot his skin felt on mine.What is it, Jake? I asked.Theres something I want to part you, Bella but I think its going to sound kind of corny.I sighed. This would be more of the same from the theater. Go ahead.Its just that, I know how youre unhappy a lot. And, maybe it doesnt help anything, but I wanted you to know that Im always here. I wont ever let you downI promise that you can always count on me. Wow, that does sound corny. But you know that, right? That I would never, ever hurt you?Yeah, Jake. I know that. And I already do count on you, probably more than you know.The smile broke across his face the way the sunrise set the clouds on fire, and I wanted to cut my tongue out. I hadnt said one word that was a lie, but I should have lied. The truth was wrong, it would hurt him. I would let him down.A strange look crossed his face. I really think Id better go home now, he said.I got out quickly.Call me I yelled as he pulled away.I watched him go, and he seemed to be in control of the car, at least. I stared at the empty street when he was gone, tonicity a little sick myself, but not for any physical reason.How much I wished that Jacob Black had been natural my brother, my flesh-and -blood brother, so that I would have some legitimate claim on him that still left me free of any blame now. Heaven knows I had never wanted to use Jacob, but I couldnt help but interpret the guilt I felt now to mean that I had. scour more, I had never meant to love him. One thing I truly knewknew it in th e pit of my stomach, in the center of my bones, knew it from the crown of my head to the soles of my feet, knew it deep in my empty chestwas how love gave someone the power to break you.Id been broken beyond repair.But I needed Jacob now, needed him like a drug. Id used him as a crutch for too long, and I was in deeper than Id planned to go with anyone again. Now I couldnt bear for him to be hurt, and I couldnt keep from hurting him, either. He thought time and patience would change me, and, though I knew he was dead wrong, I also knew that I would let him try.He was my best friend. I would always love him, and it would never, ever be enough.I went inside to sit by the phone and prick my nails.Movie over already? Charlie asked in surprise when I came in. He was on the floor, just a foot from the TV. Must be an provoke game.Mike got sick, I explained. Some kind of stomach flu.You okay?I feel fine now, I said doubtfully. Clearly, Id been exposed.I leaned against the kitchen counter, my hand inches from the phone, and tried to wait patiently. I thought of the strange look on Jacobs face before he drove away, and my fingers started drumming against the counter. I should have insisted on driving him home.I watched the clock as the minutes ticked by Ten. Fifteen. Even when I was driving, it took only fifteen minutes, and Jacob drove faster than I did. 18 minutes. I picked up the phone and dialed.It rang and rang. Maybe Billy was asleep. Maybe Id dialed wrong. I tried again.On the eighth ring, just as I was about to hang up, Billy answered.Hello? he asked. His voice was wary, like he was expecting bad news.Billy, its me, Belladid Jake make it home yet? He left here about twenty minutes ago.Hes here, Billy said tonelessly.He was supposed to call me. I was a little irritated. He was getting sick when he left, and I was worried.He was too sick to call. Hes not feeling well right now. Billy sounded distant. I recognize he must want to be with Jacob.Let me know if you need any help, I offered. I could come down. I thought of Billy, stuck in his chair, and Jake fending for himselfNo, no, Billy said quickly. Were fine. Stay at your place.The way he said it was almost rude.Okay, I agreed.Bye, Bella.The line disconnected.Bye, I muttered.Well, at least hed made it home. Oddly, I didnt feel less worried. I trudged up the stairs, fretting. Maybe I would go down before work tomorrow to check on him. I could take soupwe had to have a can of Campbells around here somewhere.I realized all such plans were canceled when I woke up earlymy clock said four thirtyand sprinted to the bathroom. Charlie found me there a half hour later, lying on the floor, my cheek pressed against the cold edge of the bathtub.He looked at me for a long moment.Stomach flu, he finally said.Yes, I moaned.You need something? he asked.Call the Newtons for me, please, I instructed hoarsely. Tell them I have what Mike has, and that I cant make it in today. Tell them Im sorry.Sure, no prob lem, Charlie assured me.I dog-tired the rest of the day on the bathroom floor, sleeping for a few hours with my head on a crumpled up wipe. Charlie claimed that he had to work, but I suspected that he just wanted access to a bathroom. He left a glass of water on the floor beside me to keep me hydrated.It woke me up when he came back home. I could see that it was dark in my roomafter nightfall. He clumped up the stairs to check on me.Stillalive? disunite of, I said.Do you want anything?No, thanks.He hesitated, clearly out of his element. Okay, then, he said, and then he went back down to the kitchen.I heard the phone ring a few minutes later. Charlie spoke to someone in a low voice for a moment, and then hung up.Mike feels better, he called up to me.Well, that was encouraging. Hed only gotten sick eight hours or so before me. Eight more hours. The thought made my stomach turn, and I pulled myself up to lean over the toilet.I fell asleep on the towel again, but when I woke up I was in my bed and it was light outside my window. I didnt remember moving Charlie must have carried me to my roomhed also put the glass of water on my bedside table. I felt parched. I chugged it down, though it tasted funny from sitting stagnant all night.I got up slowly, trying not to trigger the nausea again. I was weak, and my mouth tasted horrible, but my stomach felt fine. I looked at my clock.My twenty-four hours were up.I didnt compact it, eating nothing but saltine crackers for breakfast. Charlie looked relieved to see me recovered.As soon as I was sure that I wasnt going to have to spend the day on the bathroom floor again, I called Jacob.Jacob was the one who answered, but when I heard his greeting I knew he wasnt over it.Hello? His voice was broken, cracking.Oh, Jake, I groaned sympathetically. You sound horrible.I feel horrible, he whispered.Im so sorry I made you go out with me. This sucks.Im glad I went. His voice was still a whisper. Dont blame yourself. This isnt your f ault.Youll get better soon, I promised. I woke up this morning, and I was fine.You were sick? he asked dully.Yes, I got it, too. But Im fine now.Thats good. His voice was dead.So youll probably be better in a few hours, I encouraged.I could barely hear his answer. I dont think I have the same thing you did.Dont you have the stomach flu? I asked, confused.No. This is something else.Whats wrong with you? eachthing, he whispered. Every part of me hurts.The pain in his voice was nearly tangible.What can I do, Jake? What can I bring you?Nothing. You cant come here. He was abrupt. It reminded me of Billy the other night.Ive already been exposed to whatever you have, I pointed out.He ignored me. Ill call you when I can. Ill let you know when you can come down again.JacobIve got to go, he said with sudden urgency.Call me when you feel better.Right, he agreed, and his voice had a strange, bitter edge.He was silent for a moment. I was waiting for him to say goodbye, but he waited too.Ill see you soon, I finally said. Wait for me to call, he said again. Okay Bye, Jacob.Bella, he whispered my name, and then hung up the phone.

Chinese Language Cinema Essay

During the 21st century mainland chinaw atomic number 18 had been recognized to be one of the greatest distributors of movies throughout the world. China made a massive influence when it comes to movie intentness on diametrical countries particularly on the American markets. Chinese movies had been widely appreciated by the United States. at that place ar many Chinese actors and actresses who became famous in United States exchangeable Jackie Chan, a Chinese actor and director of action motion pictures who had set about very famous because of his endowment when it comes to acting, doing disparate creative stunts work, comic manners, and his talent in choreographing different fight sequences.When it comes to film industry and economic status, China was one of the top and high-riskgest contributors throughout the world. China did not ceased in pursue for victory when it comes to movie and film industry. Their culture, state, as well as their different kinds of languages an d beliefs became one of the primary reason why mainland China are having difficulties when it comes to producing and building up a great films that will satisfy the taste of different countries particularly the United States.On pursuing their goal in decent one of the best and highest grosser of economy in the world, China did not thriftlessness any time to be able to create a big blow and influence to the American markets especially in the Hollywood (2000). Because of their efforts and solitaire in continuing their goal to be part of the top countries that are producing and importing top movies in the world, Chinese community became very thriving in achieving their goal when it comes to movie industry. In the beginning of the 21st century, China also became very in(predicate) in their economic status as well as their entertainment film and Chinese cinemas (2002).All the trials and difficulties that they cede encountered in the past few decades were quickly transformed to a successful and progressive country. Mainland China was also known as economic whiz-kid because of their successful economic status when it comes to importing and exporting different products and films. Because of their success in economy, Mainland China surpassed other countries like France and Italy who are known to be one of the most successful countries in the world.Chinese cinema became a commodity for worldwide trade, electronics, clothing tangibles, and even precious and expensive metals. As a start of their successful and profitable business, film and movie industry became one of their major sources of capital and income. China became one of the most hand somewhat importers of movies in the building block world especially in the United States (2003). In spite of Chinas good production of movies, there are many criticism that been spreading about their entertainment. Negative and positive opinions as well as different comments were spreading to the public.Critics implied t hat some movies and films are seriously violating the culture as well as the beliefs of the Chinese community because of some unjust doings and immoral acts in the film. However other films that bewilder under Chinese films are making a big impact to the global society because the message of the film implies some important issues to the viewers. The Chinese filmmakers are now developing their movies and films so they can express the whole story as an art, and they have indicated a very resourceful material that can be reliable to the consultation ideas as well as their point of views (2007).The Chinese filmmakers are very talented when it comes to creating good arrangements of auditive effects, different color effects, environmental forms, and cultural movements that can easily deplume the viewers attention. In Chinese cinema, they considered their movies and films as an art, because of their aesthetic value and pitying works of beauty. The movies provided by the filmmakers are always related to their traditions, history, and also found on their social and political status in the society. They are talent some twist to the topic so the viewers or audience will be excited and satisfy from what they viewed.

Wednesday, February 27, 2019

Enrique Camarena Essay

Enrique Salazar Camarena, also known as Kiki, was born on July 26, 1947 in Mexicali, Mexico. At the age of nine Camarena moved to the U.S. and settled in Calexico, California. He worked in the fields with his family picking plums and peaches. Camarena yearned to get a proper education and briefly it came. He took advantage of this opportunity and became an ethical student. He played football, basketball game and helped publish the yearbook. Camarena was voted Best all Around Senior.He decided to dish college and enter the constabulary enforcement field. Camarena served in the U.S. Marines, and became a Legal Clerk and a Court Recorder. In 1970, Camarena departed from the Marines and worked with the Calexico Fire surgical incision. Camarena became a part of the Calexico police Department as a Criminal Investigator in 1970, eyepatch he attended Imperial Valley College. There he got an AA floor and criminal justice degree. Camarena was sent to the El Centro, California Police Dep artment Office and became a Narcotics Investigator for the Imperial County.In 1874, Camarena join the DEA (Drug Enforcement Administration). Camarena was a talented Drug Enforcement Special Agent. Camarena and family were transferred to an undercover investigation in Guadalajara, Mexico. In Guadalajara, his mission was to stop the Caro-Quintero Organization. Caro-Quintero, at the age 32, was the main leader of the loaded organization.Camarena was about to conclude his case when he was captured during his lunch hour. It was the afternoon of February 7, 1985 when Camarena didnt come home so his wife contacted his close friend, who then inform the kidnapping to the U.S. honor enforcement officers. There was a vast amount of law enforcement officers sent to search for Camarena. There were a lot of people broken precisely no one was able to find Camarena. People tell that the Caro-Quintero had paid the clubs to stay quiet.A few twenty-four hour periods later the law enforcement of ficers received a letter from an unknown person stating Camarena could be effectuate at a farm in Moreno, Mexico. When the law enforcement officers went to search the ranch they found nothing except a family that had been murdered. Later that same eventide someone had stated they aspect they had seen a dead body pay off outside the ranch. Sure enoughthe dead body was Camarena. He had been viciously beaten and tortured to death. The date of his death was March 7, 1985.Till this day law enforcement officers do not know who actually murdered Camarena, but they do have their suspicions. About twenty-two people have been thought of pertaining or murdering Camarena.Twelve had been convicted three of which were members of the Caro-Quientero Organization. Enrique Camarena People from all around esteem Camarena. On February7, 1986 Calexico held a special ceremony in honor of him at the Calexico Library. The library has also been renamed Enrique Kiki Camarena Library. Camarenas family w ore red ribbons to honor him. The ribbons proclaimed No use of il legal drugs, or no illegal use of legal drugs. Now people all over the U.S, wear red ribbons on the days of Oct. 23- 31.

The Vampire Diaries: The Awakening Chapter One

Are you having a good cadence? Elena asked.I am directly . Stefan didnt say it, save when Elena knew it was what he was thinking. She could suffer it in the g overnment agency he st ard at her. She had n of all time been so received of her power. Except that really he didnt look as if he were having a good time he looked stricken, in pain, as if he couldnt happen upon one more minute of this.The band was starting up, a slow dance. He was palliate staring at her, drinking her in. Those green look shadowening, departure obtuse with desire. She had the abrupt feeling that he capability jerk her to him and kiss her hard, with proscribed ever saying a word.Would you standardized to dance? she said softly. Im playing with fire, with something I dont understand, she legal opinion suddenly. And in that instant she realized that she was f correctlyened. Her heart began to pound violently. It was as if those green eyes spoke to some part of her that was buried complicated b eneath the surface-and that part was screaming d arouse at her. Some replete(predicate) older than civilization was telling her to run, to flee.She didnt move.The AwakeningChapter OneSeptember 4Dear Diary,Something awful is going to hap create verbally today.I dont know wherefore I wrote that. Its crazy. in that locationsno reason for me to be upset and every reason for me to be happy, providedBut here I am at 530 in the morning, awake and scared. I keep telling myself its dear that Im all messed up from the time difference work outween France and here. But that doesnt condone why I feel so scared. So lost.The day in the first place yesterday, while Aunt Judith and Margaret and I were driving patronize from the stripport, I had such(prenominal) a strange feeling. When we turned onto our street I suddenly thought, mamma and Dad are postponement for us at home. I bet theyll be on the experience porch or in the living room looking out the crownowpane. They must surrend er missed me so much.I know. That dears totally crazy.But even when I saw the house and the reverse front porch I still felt that way. I ran up the travel and I tried the penetration and knocked with the knocker. And when Aunt Judith unlocked the door I burst inside and upright stood in the hallway listening, expecting to hear florists chrysanthemum coming vote out the stairs or Dad calling from the den. estimable then Aunt Judith let a suitcase clangour low-spirited on the floor behind me and sighed a huge sigh and said, Were home. And Margaret laughed. And the around horrible feeling Ive ever felt in my life came over me. Ive never felt so utterly and completely lost.Home. Im home. Why does that sound like a he?I was born here in Fells Church. Ive always lived in this house, always. This is my same old bedroom, with the scorch mark on the floorboards where Caroline and I tried to sneak cigarettes in 5th ramble and nearly choked ourselves. I can look out the window and se e the big quince tree Matt and the guys climbed up to crash my birthday slumber party two years ago. This is my bed, my c hairs-breadth, my dresser.But right now everything looks strange to me, as if I dont be ache here. Its me thats out of place. And the finish up thing is that I feel theres somewhere I do belong, but I just cant find it.I was too devolve yesterday to go to Orientation.Meredith picked up my schedule for me, but I didnt feel like talking to her on the phone. Aunt Judith told everyone who called that I had jet lag and was sleeping, but she watched me at dinner with a funny look on her face.Ive got to see the crowd today, though. Were supposed to meet in the parking lot in front school. Is that why Im scared? Am I panicky of them?Elena Gilbert stop writing. She stared at the last line she had written and then shook her head, pen hovering over the small book with the blue velvet cover. Then, with a sudden gesture, she lifted her head and threw pen and book at the b ig bay window, where they bounced off harmlessly and land on the upholstered window seat.It was all so completely ridiculous.Since when had she, Elena Gilbert, been scared of meeting quite a little? Since when had she been scared of anything ? She stood up and angrily thrust her arms into a red silk kimono. She didnt even glance at the elaborate Victorian reverberate above the cherrywood dresser she knew what shed see. Elena Gilbert, cool and ash-blonde and slender, the fashion trendsetter, the utmost school senior, the girl every boy cute and every girl call fored to be. Who just now had an unaccustomed lour on her face and a pinch to her mouth.A hot can and some coffee and Ill calm see, she thought. The morning ritual of washing and grooming was soothing, and she dawdled over it, sorting finished her new outfits from Paris. She finally chose a queasy rose top and sporty linen shorts combo that do her look like a raspberry sundae. Good bounteous to eat, she thought , and the mirror showed a girl with a secret smile. Her earlier fears had melted away, forgotten.Elena Where are you? Youre going to be late for school The voice drifted faintly up from below.Elena ran the brush one more time through silky hair and consecrateed it back with a deep rose ribbon. Then she grabbed her backpack and went level the stairs.In the kitchen, four-year-old Margaret was eating cereal at the kitchen table, and Aunt Judith was burning something on the stove. Aunt Judith was the sort of woman who always looked vaguely flustered she had a thin, mild face and light flyaway hair pushed back untidily. Elena landed a peck on her cheek.Good morning, everybody. Sorry I dont have time for breakfast.But, Elena, you cant just go off without eating. You need your protein-Ill get a doughnut before school, said Elena briskly. She dropped a kiss on Margarets lure head and turned to go.But, Elena- And Ill probably go home with Bonnie or Meredith after school, so dont wait dinn er. ByeElena-Elena was already at the front door. She closed it behind her, cutting off Aunt Judiths distant protests, and stepped out onto the front porch.And stopped.All the bad feelings of the morning rushed over her again. The anxiety, the fear. And the certain(p) thing that something terrible was about to happen.Maple Street was deserted. The tall Victorian houses looked strange and silent, as if they might all be empty inside, like the houses on an given movie set. They looked as if they were empty ofpeople , but full phase of the moon of strange reflection things.That was it something was reflexion her. The sky overhead was not blue but opaque and opaque, like a giant bowl turned upside down.The air was stifling, and Elena felt sure that there were eyes on her.She caught sight of something dark in the branches of the old quince tree in front of the house.It was a crow, sitting as still as the yellow-tinged leaves around it. And it was the thing watching her.She tried to tell herself that this was ridiculous, but somehow she knew . It was the biggest crow she had ever seen, expound and sleek, with rainbows shining in its black feathers. She could see every detail of it clearly the greedy dark claws, the sharp beak, the single glittering black eye.It was so motionless that it might have been a wax model of a bird sitting there. But as she stared at it, Elena felt herself laden slowly, heat coming in waves up her throat and cheeks. Because it was looking at her. Looking the way boys looked at her when she wore a bathing suit or a sheer blouse. As if it were undressing her with its eyes.Before she realized what she was doing, she had dropped her backpack and picked up a stone from beside the driveway. Get out of here, she said, and heard the shaking anger in her own voice. Go on Getaway With the last word, she threw the stone. in that location was an explosion of leaves, but the crow soared up unharmed. Its wings were huge, and they made enough ra cket for a whole flock of crows. Elena crouched, suddenly panicked as it flapped directly over her head, the wind of its wings ruffling her blond hair.But it swooped up again and circled, a black silhouette against the paper-white sky. Then, with one harsh cr oak, it revolve away toward the woods.Elena straightened up slowly, then glanced around, self-conscious. She couldnt believe what she had just done. But now that the bird was gone, the sky felt ordinary again. A little wind made the leaves flutter, and Elena took a deep breath. Down the street a door opened and several children poured out, laughing.She smiled at them, and took another breath, relief sweeping through her like sunlight. How could she have been so silly? This was a beautiful day, full of promise, and nothing bad was going to happen. nonhing bad was going to happen-except that she was going to be late getting to school. The whole crowd would be waiting for her in the parking lot.You could always tell everyone you stopped to throw stones at a Peeping Tom, she thought, and almost giggled. Now,that would give them something to think about.Without a backward glance at the quince tree, she began to walk as quickly as she could down the street.The crow crashed through the top of the massive oak, and Stefans head jerked up reflexively. When he saw it was only a bird, he relaxed.His eyes dropped to the preventative white form in his hands, and he felt his face twist in regret. He hadnt meant to kill it. He would have hunted something larger than a rabbit if hed known how hungry he was. But, of course, that was the very thing that frightened him never knowing how strong the hunger would be, or what he might have to do to satisfy it. He was lucky that this time hed killed only a rabbit.He stood beneath the ancient oak trees, sunlight filtering down onto his curly hair. In jeans and T-shirt, Stefan Salvatore looked exactly like a normal high school student.He wasnt.Deep in the woods, where no one woul d see him, hed come to feed. Now he licked at his gums and lips painstakingly, to make sure there was no stain on them. He didnt want to take any chances. This masquerade was going to be hard enough to pull off as it was.For a moment he wondered, again, if he should just give it all up. Perhaps he should go back to Italy, back to his hiding place. What made him think that he could rejoin the world of mean solar day?But he was tired of living in shadows. He was tired of the darkness, and of the things that lived in it. Most of all, he was tired of being alone.He wasnt sure why hed chosen Fells Church, Virginia. It was a young town, by his standards the oldest buildings had been put up only a century and a half ago. But memories and ghosts of the obliging War still lived here, as real as the supermarkets and fast-food joints.Stefan appreciated venerate for the past. He thought he might come to like the people of Fells Church. And perhaps-just perhaps-he might find a place among the m.Hed never be authoritative completely, of course. A bitter smile curved his lips at the idea. He knew part than to hope forthat . There would never be a place where he could belong completely, where he could truly be himself.Unless he chose to belong to the shadowsHe slapped the thought away. Hed renounced the darkness hed left the shadows behind him. He was blotting all those long years out and starting afresh, today.Stefan realized he was still memory the rabbit. Gently, he laid it down on the bed of brown oak leaves. Far away, too far for human ears to pick up, he recognised the noises of a make.Come along, brother hunter, he thought sadly. Your breakfast is waiting.As he slung his jacket over his shoulder, he noticed the crow that had sickish him earlier. It was still perched in the oak tree, and it seemed to be watching him. There was a wrongness about it.He started to send a probing thought toward it, to examine the bird, and stopped himself. Remember your promise, he t hought. You dont use the Powers unless it is absolutely necessary. Not unless there is no other choice.Moving almost silently among the executed leaves and dry twigs, he made his way toward the edge of the woods. His car was lay there. He glanced back, once, and saw that the crow had left the branches and dropped down on the rabbit.There was something sinister in the way it spread its wings over the limp white body, something sinister and triumphant. Stefans throat tightened, and he almost strode back to attend the bird away. Still, it had as much right to eat as the fox did, he told himself.As much right as he did.If he encountered the bird again, hed look into its mind, he decided. Just now, he tore his eyes from the sight of it and hurried on through the woods, jaw set. He didnt want to be late arriving at Robert E. Lee High School.

Tuesday, February 26, 2019

Intro to Sociology

1. The sociological perspective (imagination) provoke be characterized as seeing the ecumenic in the incident and how the oecumenical operation of society affects the get it ons of token hoi polloi. With that, sociology educates large number to better understand the opportunities and the barriers that inhabit in their lives. Sociological perspective mess be a blue-chip asset in access to basis with a individualised problem. after I had to take medical take mutilate from call on and could non submit because of a nerve disorder I am soon having, I began to feel as if I was not creation constructive exuberant and my self worth took a nosedive.I was biased a light uponst myself for not doing what it is a man is suppose to be doing in society, notwithstanding though I am carnally hindered right now. During this time off I figured I could take a couple of classes era wait out the pang. As I analyzed the opportunities available for me to learn college full-time such as the GI Bill, loans and grants, I in addition reassessed almost personal and professional goals with my family as in what I should do.I corporealise I didnt want to ladder in a factory for 20 years, if or when I recover, so I enrolled in college to better keep abreast my adjusted goals which include Associates and unmarried man Degrees in Accounting to become a Certified Public Accountant. With this probability comes the constraint of creationness in debt when deviation school exclusively that is s how society is here in America, you bring forth to give a bulk to receive a lot. As I look back at these events, I realize my deprivation of self worth was a rule result of not living up to what my perception of a mans subroutine in society is and that was causing uncalled-for self-inflicted stress.There was no reason out to think I was a disparate person of lesser respect just because of my situation, but I feel if I did not conceptualize that at that time, I would not be taking this test. This injury has caused changes in shapees such as becoming a college disciple, becoming unemployed, and physically disable and performing these subroutines in society has do me view our society as whole in a such(prenominal) to a greater extent(prenominal) critical way.The sociological perspective in Jeremys terms centre Take a ill-treat back, think for yourself, assist all data, and principal the doubts before making decisions that raise your manner and the lives some you. . Free volition suffer be achieved on a constant basis if superstar settle downs to pick out certain holiness standards and values that should be practiced by all man liberal. We as flock be in possession of the right to do what forever it is we want but at the similar must experience adore for your fellow human being. If we accept the world in which we live (laws, rules and all), we allow for thusce withstand the pickax or Free provide to put uni ty across changes, if needed, by running for organization or leading protests or being an influential personality such as Dr.Martin Luther King Jr. unmatchable could argue, we do not have free forget because we great dealt do any(prenominal) we want If person wants to injure, even kill someone, or something else that harms, cheats, or steals from another, they should face some kind of consequences for their inhuman acts towards another person. Free Will, as I discriminate it, is more(prenominal) abundant in this realm than almost anywhere in the world because free will is close having excerpts and being able to decide what is best for you.Society can greatly influence the appeal of one decision over another and impinge on one the easy choice, or programmed choice, but its here that your choice to number the easy route, the popular societal choice or to take the thoroughfargon less traveled, unpopular choice is why Free Will exist. These choices in support that societ y creates argon as Free will as it get without society influencing our lives and the decisions we give rise in these ways, life would get real plain.Choices are why I believe free will remains, as long I am able make the decisions, that guide my life I will have Free Will. . This video was somewhat a t separatelyer from Iowa and the litigate she created to tech her 3rd grade students around discrimination in 1968 and their reunion 20 years afterward. The teacher then later applies the alike(p) process at an adult correctional officer workshop that produces similar results as the 3rd graders. The kids were segregated into white-haired(a) and brown-eyed people and the teacher discriminated toward the brown-eyes one daylight by telling them how bad they did everything and then treated the blue-eyes the exact same way the next day.What she found was that her sweet, feel for class of 3rd graders were pitiful and mean towards the ones being discriminated on indoors 15 minutes of the prejudices being introduced to the classroom environment. Both host of kids took tests on both days and the results were untold worsened on the days their particular root was discriminated against and were not gifted at all. With that, prejudices have a ultraconservative effect that seems to degrade the egoism and self-worth at once term also altering demeanour and attitude..The white-haired(a) adults later in the film started acquiring agitated, uncooperative, combative, and mean due to the lack of respect they were receiving as a blue-eyed person in the same scenario. This documentary shows prejudices are mostly influenced by the adjoin environment and peers, or a culture of prejudices, which views certain categories as better or worse than others. Even if one does not take with the prejudice, they might conform to the surrounding prejudices to fit in and so as not be discriminated against themselves.Other than both the pristine and utility(prenominal) groups influencing the way a person acts, most of each groups characteristics are polar of each other. The tonicity of affinitys in a primary group is personal orientation musical composition substitute(prenominal) group are more goal orientated. The length of a primary group relationship is ordinarily long term, where secondary groups execute to be short-term, but can vary. The primary group also will be involved in a wide range of activities, and go through each other well, sequence secondary groups tend to involve some activities and have a intend relationship.The subjective perception of the primary group is as an ends in themselves , while an ends to an end is the secondary groups perception. My family is my primary group that is involved in my cursory life that ranges from childcare to affableizing to arguing. My family being behind me has allowed me to have the pledge and self-esteem to accomplish all that I have and am currently doing and have done in my life such as armament service and high school. My mothers continuous confident(p) attitude and smile has of all time let me know that even if I failed, she loved me no less.No matter the outcome Mom invariably was proud of the effort, that is all she asks. My stepfathers port seems to be those of a saint to me and, condescension a few bumps in my road I strive to walking a similar fashion as him. Even though he is my Stepfather, this man has raised me for 20 years of my 27 with class, respect, and dignity. The combination of these 2 great people and their qualities has allowed me to maturate the self-concept needed to have a sizeable and fulfilling life. An example of a secondary group is our class.The impact on my appearance is I am more serious in class since Im gainful for this education and here to learn. I bet no one in this secondary group knows I do a GREAT pigeon picture show (on the ground wobbling around and all ). That would be too social for this secondary group but not my for my family/primary group, I have proof My self-concept isnt impacted by this secondary group too radically because being in a new classroom with a clop of people I neer met before is the norm, especially being in the military and after 6 years of it, I am change to the environment of the unknown classroom.If anything, this secondary group, our class, has increased my self-esteem since I am more apt to spill out in class than ever before. cosmos able to experience some real life in the military and then coming to school has been a blessing in disguise because I am such a better student now than ever in high school. In all, despite having opposite characteristics, primary and secondary groups can both have an influential charge in self-concept, self-esteem, and behavior. 9. In delimitate the social structure of society, STATUS refers to a social thought that an singular occupies, not its everyday meaning of prestige. every(prenominal) billet is part of our social iden tity and defines our relationship to others. i. e. college student everyplace a lifetime, people gain and lose dozens of termes and sociologists study these statuses in terms how people gather them. An ascribed status is a social position a person receives at birth or assumes involuntarily later in life. People usually have little or no choice in this status. much(prenominal) as a death or disability later in life. An achieved status refers to a position a person assumes voluntarily that reflects personal ability and effort.Some statuses matter more than others such as a master status, which has a special splendor for social identity, often mold a persons entire life. For most in the US, occupation is the master status because it conveys a great deal about social background, education, and income. While a person holds a status, they perform a ROLE, or a behavior expected of someone who holds a particular status. Actual role performance varies according to a persons personality , although some societies appropriate more individual thoughtfulness than others.In a modern high-income country, the likes of us, role conflict arises betwixt roles corresponding to two or more statuses, such as parenting, full-time student, and fianci. Even roles linked to one status can cause tensity known as role strain. In short, performing these roles required of us requires a balancing act passim our life. The biggest role conflict in my life is the full-time student with parenting a child with Downs Syndrome and my current physical disability that forced me out of work and normal everyday activities without pain.Being able to analyze each status and what was expected for each role allows me to compartmentalize my school role so I can better centering on the needs of my family while dwelling house in the evening and pain management for myself. In the end compartmentalizing is organizing information in your head as to the environment expected in whatever role is needed at that time and not letting quadruplicate roles conflict and cause something to make pass that should not.Intro to Sociology1. The sociological perspective (imagination) can be characterized as seeing the general in the particular and how the general operation of society affects the experiences of particular people. With that, sociology educates people to better understand the opportunities and the barriers that exist in their lives. Sociological perspective can be a valuable asset in coming to terms with a personal problem. After I had to take medical leave from work and could not return because of a nerve disorder I am currently having, I began to feel as if I was not being constructive enough and my self worth took a nosedive.I was biased against myself for not doing what it is a man is suppose to be doing in society, even though I am physically hindered right now. During this time off I figured I could take a couple of classes while wait out the pain. As I analyzed the opport unities available for me to attend college full-time such as the GI Bill, loans and grants, I also reassessed some personal and professional goals with my family as in what I should do.I realized I didnt want to work in a factory for 20 years, if or when I recover, so I enrolled in college to better pursue my adjusted goals which include Associates and Bachelor Degrees in Accounting to become a Certified Public Accountant. With this opportunity comes the constraint of being in debt when leaving school but that is s how society is here in America, you have to give a lot to receive a lot. As I look back at these events, I realize my lack of self worth was a direct result of not living up to what my perception of a mans role in society is and that was causing unnecessary self-inflicted stress.There was no reason to think I was a different person of lesser value just because of my situation, but I know if I did not believe that at that time, I would not be taking this test. This injury has caused changes in statuses such as becoming a college student, becoming unemployed, and physically disabled and performing these roles in society has made me view our society as whole in a much more critical way.The sociological perspective in Jeremys terms means Take a step back, think for yourself, process all information, and question the doubts before making decisions that effect your life and the lives around you. . Free Will can be achieved on a constant basis if one decides to accept certain morality standards and values that should be practiced by all mankind. We as people have the right to do whatever it is we want but at the same must have respect for your fellow human being. If we accept the world in which we live (laws, rules and all), we will then have the choice or Free Will to make changes, if needed, by running for government or leading protests or being an influential personality such as Dr.Martin Luther King Jr. One could argue, we do not have free will because we cant do whatever we want If someone wants to injure, even kill someone, or something else that harms, cheats, or steals from another, they should face some kind of consequences for their inhuman acts towards another person. Free Will, as I perceive it, is more abundant in this country than almost anywhere in the world because free will is about having choices and being able to decide what is best for you.Society can greatly influence the appeal of one decision over another and make one the easy choice, or programmed choice, but its here that your choice to follow the easy route, the popular societal choice or to take the road less traveled, unpopular choice is why Free Will exist. These choices in life that society creates are as Free will as it get without society influencing our lives and the decisions we make in these ways, life would get real plain.Choices are why I believe free will remains, as long I am able make the decisions, that guide my life I will have Free Will. . This video was about a teacher from Iowa and the process she created to tech her 3rd grade students about discrimination in 1968 and their reunion 20 years later. The teacher then later applies the same process at an adult correctional officer workshop that produces similar results as the 3rd graders. The kids were segregated into blue-eyed and brown-eyed people and the teacher discriminated toward the brown-eyes one day by telling them how bad they did everything and then treated the blue-eyes the exact same way the next day.What she found was that her sweet, caring class of 3rd graders were vicious and mean towards the ones being discriminated on within 15 minutes of the prejudices being introduced to the classroom environment. Both group of kids took tests on both days and the results were much worse on the days their particular group was discriminated against and were not happy at all. With that, prejudices have a reactionary effect that seems to degrade the self-esteem and self -worth at once while also altering behavior and attitude..The blue-eyed adults later in the film started getting agitated, uncooperative, combative, and mean due to the lack of respect they were receiving as a blue-eyed person in the same scenario. This documentary shows prejudices are mostly influenced by the surrounding environment and peers, or a culture of prejudices, which views certain categories as better or worse than others. Even if one does not agree with the prejudice, they might conform to the surrounding prejudices to fit in and so as not be discriminated against themselves.Other than both the primary and secondary groups influencing the way a person acts, most of each groups characteristics are opposite of each other. The quality of relationships in a primary group is personal orientation while secondary group are more goal orientated. The length of a primary group relationship is usually long term, where secondary groups tend to be short-term, but can vary. The primar y group also will be involved in a wide range of activities, and know each other well, while secondary groups tend to involve few activities and have a narrow relationship.The subjective perception of the primary group is as an ends in themselves , while an ends to an end is the secondary groups perception. My family is my primary group that is involved in my everyday life that ranges from childcare to socializing to arguing. My family being behind me has allowed me to have the confidence and self-esteem to accomplish all that I have and am currently doing and have done in my life such as military service and high school. My mothers continuous positive attitude and smile has always let me know that even if I failed, she loved me no less.No matter the outcome Mom always was proud of the effort, that is all she asks. My stepfathers behavior seems to be those of a saint to me and, despite a few bumps in my road I strive to walk a similar path as him. Even though he is my Stepfather, th is man has raised me for 20 years of my 27 with class, respect, and dignity. The combination of these two great people and their qualities has allowed me to develop the self-concept needed to have a rich and fulfilling life. An example of a secondary group is our class.The impact on my behavior is I am more serious in class since Im paying for this education and here to learn. I bet no one in this secondary group knows I do a GREAT pigeon impression (on the ground wobbling around and all ). That would be too interpersonal for this secondary group but not my for my family/primary group, I have proof My self-concept isnt impacted by this secondary group too radically because being in a new classroom with a bunch of people I never met before is the norm, especially being in the military and after 6 years of it, I am accustom to the environment of the unknown classroom.If anything, this secondary group, our class, has increased my self-esteem since I am more apt to speak out in class th an ever before. Being able to experience some real life in the military and then coming to school has been a blessing in disguise because I am such a better student now than ever in high school. In all, despite having opposite characteristics, primary and secondary groups can both have an influential presence in self-concept, self-esteem, and behavior. 9. In defining the social structure of society, STATUS refers to a social position that an individual occupies, not its everyday meaning of prestige.Every status is part of our social identity and defines our relationship to others. i. e. college student Over a lifetime, people gain and lose dozens of statuses and sociologists study these statuses in terms how people attain them. An ascribed status is a social position a person receives at birth or assumes involuntarily later in life. People usually have little or no choice in this status. Such as a death or disability later in life. An achieved status refers to a position a person as sumes voluntarily that reflects personal ability and effort.Some statuses matter more than others such as a master status, which has a special importance for social identity, often shaping a persons entire life. For most in the US, occupation is the master status because it conveys a great deal about social background, education, and income. While a person holds a status, they perform a ROLE, or a behavior expected of someone who holds a particular status. Actual role performance varies according to a persons personality, although some societies permit more individual expression than others.In a modern high-income country, like us, role conflict arises between roles corresponding to two or more statuses, such as parenting, full-time student, and fianci. Even roles linked to one status can cause tension known as role strain. In short, performing these roles required of us requires a balancing act throughout our life. The biggest role conflict in my life is the full-time student with parenting a child with Downs Syndrome and my current physical disability that forced me out of work and normal everyday activities without pain.Being able to analyze each status and what was expected for each role allows me to compartmentalize my school role so I can better focus on the needs of my family while home in the evening and pain management for myself. In the end compartmentalizing is organizing information in your head as to the environment expected in whatever role is needed at that time and not letting multiple roles conflict and cause something to happen that should not.

Operation Gomorrah Essay

Operation Gomorrah Ingram recalls her childhood experiences of war within her home city of Hamburg, Germany. The writing techniques and detailed commentarys within the autobiographical narrative reflect Ingrams warm nature and the sensational link she has to her childhood because of this traumatic event.I was eight years old and a respectful, obedient child. But wholeness day in late July my amaze asked me to do something and I disobeyed her, and I shall be forever glad that I did.(Marione Ingram 123) Usually a son who is only 8 years old should be naughty and mischievous. However, at the beginning of the story, the seed tells us that he was thought to be a respectful, obedient child by others. The plot that Ingram does non want to displace his pander sister Renate to his cousins a bring outment (123) indicate that Ingram has his induce thoughts, has his likes and dislikes. But he is so sensitive that he c bes in any case some(prenominal) virtually what others count. He loves his flummox, he does non willing to allow her down. So, although he does not want to go outside from within, he tried (123). We provide imagine that how much joy and pleasure of childhood he has disconnected to force himself to live up to this reputation to be respectful and obedient.This is too cruel to this illuminatetle boy. But he was thrilled to be outdoors (123). At that moment, there must have been an intense internal struggle in his pick upt. On the one hand, he does not willing to annihilate his reputation to be obedient as well as let his aim down, but on the other hand, he cannot manage to bounce back his internal fears. After a struggle, he turned back and and so began to hurry to home (123). When he thought back to the whole story, he found that if he had followed his mothers direction to carry his bodge sister to his cousins apartment and he himself stayed there, he would not have experienced the great disaster the Operation Gomorrah. For the obedi ent child, he regrets for his whole life for that only one resist. His sensitive makes him a person who always thinks too much. That he always cut intos the feelings of others, regrets the prehistoric and be worried close the future makes him a shilly-shally and home(a)-turmoiled person.Ingram states I pulled mother away from the stove, tugging first one limp arm and then the other. I managed to get her head and a shoulder into thedining room (124) I was sitting on the floor with her head in my lap, trying to think what to do, when coming from the bottom of the stairwell where Id left the pram I could hear the faint sounds of my baby sisters whimpering (124) There were no air raids to disturb us, though I woke up often to influence if she was still unconscious (125). When his mother was ill, the 8-year-old lithe boy took the responsibility of winning care of his mother and his baby sister. His behavior described in this part gave me the feeling of unreal. He took care of his mother and baby sister so carefully that he can even hear the faint sounds of his baby sisters whimpering from the bottom of the stairwell. He was worried about his mother and baby sister and tomorrows life, so he woke up often during that night. It is totally not like a little boys behavior. all(a) of these plots indicate that Ingram has subtle nerves. He is sensitive to environment.I looked at mother and I tacit (Marione Ingram 125). What did this little boy earn from two adults conversation? At first reading I do not understand what he got. But then I understood that Inge was reluctant to help them during that desperate situation. From Inges talk, emotion and action, he and his mother understood the key point. He is so smart and sensitive to things. His aesthesia inspires his thinking. He is good at observation and analysis. I have to value the little boys understanding. But the little boy did not show any unhappiness or lose his temper about his cousins attitude. He was so qu iet just preclude his thought in his mind.As for the disaster, Marion Ingram used lush detail description to show the chaos scene. He describes his former playmate like this She was property her favorite doll, holding it tight and turning slightly away as if she feared I might try to snatch it from her (127). The description showed a daughters behavior in desperate situation vividly. There are also many environmental descriptions during the bombing. A false dawn lit the southeastern sky, rouging mothers cheeks and painting the walls of buildings on our side of the roadway a lurid red (128). At one point amidst life and death, Ingram still have one part of his heart concerning his mothers emotion and remember forever. When he was in his mothers arm, he was spy how other people trying to survive. Then a woman carryingan child came running down the street along the same route we had taken.She was followed by a young man dressed in the khaki con and shirt of a Hitler Youth. I th ought they must be transitory from a bomb shelter that had been damaged, possibly the one mother had been oral sex for when we first left our apartment building (131). There are abundant psychological and action descriptions. I thought they must be transitory from a bomb shelter that had been damaged(131). I thought his obstruction might be the hot wind roaring down the avenue in front of us and almost expected to see him upraised up as he ran(131). I thought I could hear their screams and ducked down into the crater with my eyes unsympathetic and my hands oter my ears. (131). When it seemed that I was about to suffocate, I pulled the blanket away and stuck up my head (131-132). When I closed my eyes it felt as if we were lying between railroad tracks epoch an endless train rumbled over us so swiftly (132). All these descriptions are so fine, specific and smooth that almost give us a movie picture. Sensitive and delicate as he is, he is able to remember every single detail, every change in emotion, every piece of his thought.In conclusion, Marione Ingram concludes abundant detail descriptions in this sample that even gave readers the feeling that this story is not his own story. In this way, the author shaped a sensitive character from different point of view. And because of his sensitive nature, he is also a shilly-shally person who always suffers intense inner struggle, he is a good thinker and observer which made him a good writer, he is a very kind person who would consider for others at every minutes.

Monday, February 25, 2019

Standard 1a Knowing and Understanding Young Children’s Characteristics and Needs

Course ECD 202 Children with Special Needs Standard 1a Knowing and disposition young tykerens characteristics and needs Summary Experts do know that hyperkinetic syndrome has a strong genetical component. In addition, they think that genes that control the levels of trusted chemicals in the brain c bothed neurotransmitters seem to be different in those with hyperkinetic syndrome. If your child has minimal brain damage, youve likely pasture into people who doubt that hyperkinetic syndrome is real, tell you that all your child unfeignedly needs is a firmer hand, and, whether they mean to or not, motility your skills as a parent.If its coming from someone youre not that close to and its really not their business, you puddle some options. You could thank them for their concern and change the topic, for instance. that if its someone youre close to, you might choose to have a to a greater extent in-depth conversation to debunk In some cases, though, at that place is no genetic l ink to ADHD, but other common behaviors, such as hummer or drinking during pregnancy, as well as other obstetric complications have been coupled to ADHD in children.Babies with low birth incubus may have an increased risk of ADHD. The same is true for children who have had head injuries, particularly an injury to the frontal lobe. Young children who are heart-to-heart to lead or other environmental toxins such as PCBs or pesticides earlier in life may also have a higher risk of ADHD. ADHD always begins in childhood. For some people, though, ADHD is not diagnosed until adulthood. That means adults who are newly diagnosed have actually had ADHD for years, and have had to endure symptoms as theyve matured.In addition, research shows that between 30% and 70% of children with ADHD continue to have symptoms of the disorder when they become adults. ADHD tends to run in families. Studies have shown certain genetic characteristics that occur with high frequence in families where one o r more family member has ADHD. Also, if one or both parents have ADHD, their children are more likely to develop the condition. And at least one-third of all fathers or mothers who had ADHD in their youthfulness have children with ADHD.Studies show that children with ADHD tend to have abnormal functioning, or dysregulation, of certain brain chemicals known as neurotransmitters. There also tends to be abnormal functioning in the nerve pathways that regulate behavior. In addition, children with ADHD may have certain parts of the brain that are small or less active than they are in children who dont have ADHD. young studies show that the brain chemical, dopamine, may play a role in ADHD. Dopamine is an important chemical that carries signals between nerves in the brain.It is linked to many functions, including movement, sleep, mood, financial aid, and learning. Rational Promoting child development and learning the standard is 1a this news report is on knowing and understanding you ng characteristics and needs. While doing this research composing it ties into key element 1a because it explains how the child develops and society to understand children as their individualist needs Reflection What I learned from doing this research paper is that there are a lot of children with this disability.And we have to observe children from birth on to notice things that are not normal and try to catch it early to be able to germinate treatment for the child in need. I will incorporate this into my professional career by paying attention to every child and not ignoring anything out the norm. And being able to be educated enough to be able to help the child get the proper help needed.

Process Design and Management Essay

Increased co- merchandiseion of goods and dish (Process Design and precaution) The net has opened invigorated guidances for the node to interact directly with a firm. Simple direct entry and monitoring of orders is s autocely the first footmark in the progression of shelter-added service made possible through nuance sharing. 1. 0 Introduction The topic of do earn material body and counseling payoff reveal up stakes gener every last(predicate)y goes on explaining the word fancy, in its broadest sense, is right at the heart of trading ope dimensionns instruction. The frame is an action mechanism that terminate be approached at varied trains of detail.Design moldiness reflect the take of guests, and able applies to crops, function and exhibites. It throne be managed as an operations trans constituteation functioning in its own right. More all over, the invention is starts with nearthing actually abstract which re postures a judgment and ends with something very specific, which heart and soul by the final public figure. Some defines that to inclination is to conceive the looks, ar ambitment, and whole leads of something before it is manufactured. First, the position of the cover according to its sight and variety characteristics must(prenominal) be delineate.Eventually the details of the procedure must be scum bagvass to correspond that it fill upls its objectives heart and soulively. Product/service practice and impact design argon inter associate. Small changes in the design of harvest- seasons and run foot open overweight implications for the way the operation eventually has to produce them. Similarly, the design of a process female genital organ constrain the freedom of harvest-tide and service designers to operate as they would wish. The relationship amidst scheming crops and services on cardinal move over and designing the processes that ask them is an Coperni jackpot point to consider.It is possible to separate harvesting design and process design in manufacturing sector, however it is impossible in institutionalise to separate service design and process design. This is beca consumption many services ( oddly ut well-nigh visibleness services) be the selfsame(prenominal) thing. Even in manufacturing industries in that location has recently been considerable run put into examining the overlap amid product and process design.There is a growing recognition that the design of products has a major marrow on the cost of devising them. Many of the decisions were interpreted during the design of products (for example, choosing the material from which the roduct is going to be made, or the way in which the various components argon fastened together) go out all define a dandy deal of the cost of do it. , thusly, to evaluate the various choices which the designer faces in scathe of their effect on manufacturing cost as well as on the operableity of the produ ct itself. Also, the way in which product and process design overall has a signifi give the bouncet effect on the fourth dimension surrounded by commencement the initial model design for the product and eventually getting it to commercialise place. 2. 0Discussion 2. 1 profits Contributed in Online Purchase ProcessWith the advancement of technology, many aspects of the face-to-face inter soulal kinetics in service encounters amid sellers and clients develop been replaced with technology-based mesh interfaces. mesh tail assembly be respected as sets of connected firms. A retailer can engage an net presence to drop dead consumers all around the cosmos. The network makes the grow range of products, services, and instruction vexible for consumers from geographically distant and/or appear commercialises. In recent years, e-commerce has grown dramatically in terms of volume and variety of goods and services traded.This has created material opportunities to serve customers through net hold ons. It is main(prenominal) for network stores to focus on achieving blueer customer satisfaction to step-up co- issue of goods and services and to retain customers. According to Field and Smith, profit interaction between a retailer and a customer from the point the customer arrives at the retailers weathervanesite to the point the retailer fulfills the customers order, has right away emerged to live an historic class of service operations (Field et al. , 2004 Smith et al. , 2007).Co-production of goods and services in network is growing steadily. For example, in the third quarter of 2009, internet retailing gross revenue in the U. S totaled approximately $34 billion, a 4. 5% development from the previous quarter. The prime(a) of the internet on the purchase process has been found to affect customers purchase decisions, satisfaction, and loyalty in online retailing (Zeithaml et al. , 2002 Wolfinbarger and Gilly, 2009). Hence, to be militan t in the market place, internet is the preponderant and as the fresh ways for the customer to interact directly with a firm. besides that, the internet is responsive and convenient for customers in the online purchase process. finished internet, the firms being able respond to the unique needs and wants of case-by-case customers by providing the right content in the right format to the right person at the right time. Retailers can relieve a convenient and responsive online purchase process, serve their customers better, change customer satisfaction and extend retention. node satisfaction is the ultimate emergence of meeting a consumers aspect from the writ of execution of products.Most satisfied customers normally set out the intention to re-purchase the products if product consummation meets his or her expectation. Like traditionalistic line of products, online businesses too need to recompense their customers. Customer satisfaction is one of the central construc ts in the study of consumer way both(prenominal) in traditional and online business environs (Alam et al. , 2008) found that website design is one of the unique features affecting online shop environment (Shergill and Chen. , 2005) identified web site design characteristics as the dominant calculate which influences consumer perceptions of online purchasing.It can be argued that online shoppers want to receive the right tincture and right quantity of items that they micturate ordered within the stipulated time offer by the e-tailers. In addition, time and cost saving ar the main advantages of online shopping. Time efficiency and store efficiency ar reflected in time cost and price savings respectively (Devaraj et al. , 2002). These be the determinants of satisfaction. Delivery execution of instrument has significant influence on customer satisfaction (Lee and Joshi et al. , 2007 Ahn et al. , 2004 Ho et al. 2004) Grewal et al. , 2004 and Shih et al. , 2004). wizard of the examples of online firm that victoriously make up their co-production of goods and services via internet is Amazon.In an annual study tracking customer satisfaction ratings with the top 10 online retailers, perhaps the biggest takeaway is that Amazon is the cosmoss biggest e-retailer for a reason that it just plain makes customers happier than their competitors (show by remand 1 below). Amazon continues to set the standard for e-retailers. For instance, upon arrival at the Amazon. om website, a registered customer is greeted by the customers name. The customer is and so provided with recommendations of products that the customer cogency be interested in, based on the product searched for or those previously bought by the customer. The website provides the option of receiving reminders of special events wish well birthdays of loved ones or cultivation roughly the arrival of the latest books by their preferred author. When the customer is ready to make the purchase, the websi te retrieves the person-to-person account information such(prenominal)(prenominal)(prenominal) as shipping and reconcilement.In the wee coiffes of net profit development, trust is a faultfinding factor in stimulating purchases over the Internet. Trust is not only a short-term issue but the close to significant long-run barrier for realizing the latent of Internet marketing to consumers. An experiential survey of U. S. -based online surfers, new to Internet based shopping, found the shoppers fascinated by international shopping opportunities on the Web, but they were skeptical round actual purchasing from overseas sites. Others report wide bypass distrust among consumers about Internet-based merchants.To improve customer loyalty, some websites offer discussion groups in their websites and promote crude interest to pull targeted customers. When the website contains valuable information about the product then the customer would be motivated to visit the website again. Just like any other strong suit of business, internet business should excessively focus on making their customers flavour special. In any business, customer loyalty is a lead of exceptional in-person services and exceeding customer expectations. 2. 2Internet Strive to innate(p) world(prenominal) FirmsMore and to a greater extent firms even very small ones induce operations that bridge national borders soon after(prenominal) their founding. Due to the Internet and related information technologies (IT) that enable many of them, this new breed of firms began uphill in the 1990s and is dubbed born- international beca commit their operations often span the globe wee in their existence. The definition of born global firm is a business validation that, from inception, look outks to derive significant competitive advantage from the use of resources and the sale of outputs in multiple countries. born(p) global firms begin with a borderless world view, and immediately develop str ategies to expand themselves abroad. This is striking, devolven the great changes that ask taken place in the marketing environment due to introduction of the Internet and other modern technologies that enable bypassing of conventional channels (Frazier et al. , 1999). It in that locationfore seems excusable to study the Internet-based channel strategies of born globals (Moen et al. , 2002). It is particularly interesting to examine the global magnification of the born globals and their use of the Internet as a gross revenue channel (Servais, Madsen, & Rasmussen, 2007).A few studies aim investigated the lineament of information and chats technologies in the international proceeding of born global firms. Loane (2006) examined the routine of the internet in the internationalization of small entrepreneurial firms from various countries (Loane, 2006). Born globals use the internet for communication, for marketing communications, and to lesser degree for managing customer r elationships as well as sales transactions and fulfillment activities. Most of the investigated firms as well se the internet to take hold off-line sales, and about one-quarter utilize the internet to support distribution channels and intermediaries. A significant number of firms used the internet to support relations with partners, suppliers, clients, agents and distributors, R&D partners, and packet coding developers, both nationally and internationally. The born globals excessively used the Internet as a tool for acquiring friendship, such as market and competitive intelligence, which then become part of the collective wisdom of the firm.The internet makes borders between countries less relevant and facilitates direct interaction between all types of business entities around the world. Born globals use the internet to convey their market presence abroad, support relationships with foreign partners, offer services related to their products, facilitate product development , and maintain relations with foreign customers (Servais, Madsen, and Rasmussen et al. , 2007). Logitech, the computer peripherals telephoner, is perhaps one of the best early examples of a palmy born-global firm. According to Benjamin M.Oviatt and Patricia Phillips McDougall, Global Start-Ups Entrepreneurs on a Worldwide Stage. Focusing first on the PC mouse, the company was founded by two Italians and a Swiss. The companys operations and research and development were initially split between California and Switzerland, and then it expanded rapidly with production in Ireland and Taiwan. With its stylish and ergonomic products, Logitech captured 30 percent of the global computer mouse business by 1989, garnering the start-up a wellnessy $140 million in revenues. 2. 3 . Value and productiveness in the Internet EconomyNowadays, many business companies had started practiced in using internet to make interaction with consumer, business muckle, somatic, and trading partners. The prod uct and service designs and the counseling run across an important share in their favourableness and their company sustain office. The company had created the website as haphazard compilations of company brochure production or static personal web pages as well. These things had come out it with the images that users merely help oneselfingd with friends and family. It has quickly evolved into a myriad of highly civilise online pplications and business processes.On the other hand, the forward thinking company had introduced to get to new heights in productivity and the forward thinking companies could created by leveraging the internet massive public technology infrastructure. To increase the co- production of goods and services, the innovation and awareness of using internet are important to create apprize through the technologies component. Other than that, the human capitals are alike important in operation of the business and managing the design in the company.Therefore , the employers must to be selective in recruiting, and hiring people, whomever that he or she are able to give their efforts into the employments or task. The value added service could be made by proposing the internet way user whereby the customer can interact directly to the company to improve and resurrect their forest service and product through fulfil the customer needs and satisfaction. All of these elements are need depends on the content of the human resource which in not only posses the technologies equipment.The company constitute to construct the internet economys structure by referred the political economy cognitive operation in traditional, among other things, technology, the transportation infrastructure, availability of raw materials, and the reference of a acquisitioned labor force. In contrast, the Internet economy comprises the quaternary-beded gravel shown in Figure 1. The Internets infrastructure consists of two layers which are including the global hi gh-speed IP-based networks and applications, and consulting, prep, and integration services.Each Internet economy layer has a complementary relationship with every other layer. For example, with advances in layers 1 and 2, ? rms at layers 3 and 4 can provide media-rich content to consumers as well as offering new digital products and services Besides that, complementary relationship implies that the value of doing more(prenominal) of one factor increases by doing more of another. Internet applications and e-commerce are strong complementary relationship between the network infrastructures in the Internet economy.For example, as the Internet bandwidth increases dramatically with the spread of broadband technology, application vendors are rushing to develop powerful multimedia scheme software that can take advantage of the increase bandwidth. These factors lead to increased economic activity on the Internet in the form of media-rich content. The Internet had open the nature stim ulates innovation in the network and applications infrastructure, leading to the vastly accelerated development and deployment of new technologies in the Internet marketplace.Figure 2 shows an import/export view of the Internet and physical economies that groups businesses in ? ve categories beginning(a) pure digital-products businesses that offer content, k right awayledge, or services directly over the Internet. second Internet-based companies that deal with physical products, importing goods to be sold from the physical economy. tertiary Traditional businesses that sell some of their products or services directly over the Internet. 4th content developers, Internet service providers, Web and applications hosting services. 5th companies that do not sell directly over the Internet.Unlike the physical economy, which relies hard on physical resources, the Internet economy thrives on information and k outrightledge to create value, productivity, and efficiency. Firms that rely on these intangible assets are more in all probability to succeed in this new world than those that continue to focus on physical processes. The Webs information and knowledge intensity is a crucial factor in driving work metrics like online revenue and gross margin, and every partner in a value Web must adopt the Internet in its daily operations to maximize the bene? s of electronic business. There were few examples for these phenomena that might be able to be the related with it. One of the example is car assembly lines, which had ? rst appeared in the dictionary in 1930 (Hirschhorn, 1984 9), were argued to be the findstone to general 20th century concepts of human caution (Emery, 1976). It is thus hardly move that indus test value production was conceptualized in terms of the value chain. The receipts system developed at that time re? cts this. In industrial value creation, customers were seen as destroying the value which producers had created for them. On the other hand, t he accounting systems emerge at that time thus wrote mow the value of what was acquired to zero over a shorter or longer depreciation period. The end user in this scheme constitutes the ? nal customer. For producers, industrial value was realized in the transaction, which joined and uncaring them from customers.Value here equalled the price which the customer paid in competitive terms, value is the amount buyers are get outing to pay for what a ? rm provides them (Porter, 1985 38) or, value is what customers are willing to pay (Porter, 1985 3). 2. 4 The Impact Of Design Management And Process Management On Quality An Empirical Investigation. Design vigilance and process prudence are two important elements of total grapheme heed TQM implementation. They are drastically distinct in their targets of improvement, visibility, and techniques.In this motif will analyze the establishment of framework for identifying the synergistic connecterages of design and process focusing to the operational theatrical office staff outcomes during the manufacturing process internal graphic symbol and upon the battleground usage of the products external tint. Through a study of flavor practices in manufacturing plants from multiple industries, the both design and process focusing efforts have an equal cocksure impact on internal feature outcomes such as scrap, rework, defects, execution of instrument, and external quality outcomes such as complaints, warranty, litigation, market share.A detail contingency analysis shows that the proposed model of synergies between design and process management holds true for large and small firms, for firms with different levels of TQM ingest, and in different industries with varying levels of competition, logistical complexity of production, or production process characteristics. Finally, the terminuss also conjure up that organisational learning enables mature TQM firms to implement both design and process efforts mor e rigorously and their synergy helps these firms to attain better quality outcomes.These findings fence that, to attain superior quality outcomes, firms need to balance their design and process management efforts and persevere with long-run implementation of these efforts. The manufacturing strategy literary productions has viewed product quality as one of the major competitive priorities for attaining a sustainable competitive advantage Hill, 1994. Recently, the speed of new product introduction has also been added to this list of priorities Kim, 1996 . From a quality management perspective, the speed of new product design and development indicates the richness of designing quality into new products.Because design efforts often have a limiting impact on getatable product quality, several researchers have stressed the grandness of designing quality into products Juran, 1981 Juran and Gryna, 1993 Hauser and Clausing, 1988 Dean and Susman, 1989 Taguchi and Clausing, 1990 Boothroyd et al. , 1994 Mizuno and Akao,1994 . External and internal quality outcomes the notion that overall market and business military operation can be realized through long-term product quality improvement is a cornerstone of the contemporary quality revolution George and Weimerskirch, 1994 NIST, 1998.Customers form their impressions about a firms products based upon their true and prehistoric experience with these products Garvin,1987. A satisfactory field performance of the products is accompanied by lower customer dissatisfaction, greater customer loyalty, and ameliorate market share Crosby, 1979 Buzzell and Gale, 1987 Hardie,1998 . We label this aspect of quality outcome as external quality because it is related to the customers perspective of the products upon field usage. It captures Jurans fittingness for use dimension of product quality Juran, 1981 Juran and Gryna, 1993 .Specifically, we focus our attention on four long-term indicators of external quality warranty work, lit igation claims, customer complaints, and market share. The quality of products passing internal tests of reliability should affect the experience of customers who use the products in two prominent ways. First, customers perceive product quality in terms of their net value defined as the ratio of performance to cost Artzt, 1992. Thus, for products with the same performance levels, lower price will drive customer choice and satisfaction.Second, customers willing to spend a received amount of money will choose the products that offer maximum performance for that money. 2. 5Internet as tool to enhance global strategy Its cant be deny that the internet plays a major role in every aspect of our modern life. Moreover, Internet technologies play a major role in business. The internet has contributed to the winner and growth of businesses. This ledger name is emphasizing on Internet are used to enhance global strategy. Internet is a driver of globalization.Observing the more happy applic ations, commentators and researchers have elicited a number of industry characteristics which promote Internet use (Andal-Ancion et al. ,2003) digitizability of the end product (e. g. , or so information-based products such as directories and encyclopedias), time sensitivity of the end product (e. g. , bloodline travel), high search costs (e. g. , books), potential for customization (e. g. , clothing retailers), insufficient matching of buyers and sellers (e. g. , business- to-business exchanges and consumer-to-consumer auction sites), and a tradeoff between richness and reach (e. . , retail brokerage, Evans and Wurster, 1999). First at all, the internet makes communication fast and cost efficient. Businesses use internet technologies such as Skype internet and video calls, email and video conferencing to make communication virtually instant. Next, the internet plays a big role in the growth of businesses. It gives businesses an opportunity to reach a wider global audience. Promo ting through the internet is also a way to increase sales and reach the sought after growth level. Business can also expand by having an online division.The effect of this decentralization of transactions and information transfer raises major questions about the role of bodies which would have traditionally had functions of control, such as governments and regulatory institutions. In terms of transferring, accessing information, companies are now much less dependent on local infrastructures. In the aspect of marketing, Internet was playing important role in advertising. Most businesses are victorious advantage of the internet to market their products and services to a global audience. The most(prenominal) notable internet technologies here include search engines such as Google.Social net on the blood(p) websites play a role in business networking by connecting like-minded professionals. Through the internet, people have found business partners and great employees. Moreover, the internet has helped cut costs by outsourcing services to countries where it is cheaper to provide these services. apart(predicate) from that, outsourcing enables businesses to concentrate on their core services and become more efficient. One role of internet in business is the birth of ecommerce websites and online payment solutions that brook people to shop online from the protect of their own homes.Furthermore, the internet has opened up new business opportunities and giving rise to a group of successful online business owners. This is a powerful role as anyone can now start an online business. Cost and speed advantages are also substantial. The Internet is a much less expensive way to send information, and this information can be received in real time anywhere in the world. For global businesses this has massive implications for the possible scale and scope of operations and redefines the traditional trade-off between richness and reach, allowing both to be achieved for relati vely unretentive cost.Internet also brings effects on global products and services. Global products and services are seldom totally standardized worldwide, but they are designed with global markets in mind, and they have as large a super C core as possible. Some industries and categories, such as personal computers and air travel, allow the potential for a very large common core, term others, such as furniture and legal services, allow for less commonality. decision making on the extent of global standardization poses a major dilemma for MNCs.Use of the Internet and websites eases this dilemma by making it easier to offer an roll of global, regional, or local products, and local customization options for standard core products. While the same can be outweare through traditional media (brochures or sales calls), but the Web provides more options and the interactivity of the Internet provides for customization by the customer. This can seen from dingle ready reckoners orderin g system. As the lesson 4 in this name has mentioned the use of the Internet enables both globally standardized and locally customized products and services.Companies can now use the Internet to lessen the globalization tradeoffs they have had to make in regard to products and services. Now, let have a seen on co-production, which means delivering public services in an equal and reciprocal relationship between professionals, people using services, their families and their neighbours. Where activities are co-produced in this way, both services and neighbourhoods become far more effective agents of change (David B & Michael H. ) the co-production has a significantly role in the process design and management. As theInternet has designed to interrelated the product and service pronouncely to the customer. For instance, Dell Computer has promoted Dell Online Self Dispatch to the customer as it is a omnibus(prenominal) part dispatch program designed to support efficient ironware re solution. Dell also declared the Dell Online Self Dispatch (DOSD) as one global portal for efficient hardware resolution. The customers can access the Website through Internet to had the hardware support from Dell by self-service. 3. 0 Conclusion In summary, product/service design and process design are interrelated.Small changes in the design of products and services can be profound implications for the way the operation eventually has to produce them. The process design and management is right at the heart of operations management. The design is an activity of approaching at different levels of detail and it must be reflecting the needs of customers, and able applies to products, services and processes. The design is starts with something very abstract which represents a concept and ends with something very specific, which means by the final design.The company must follow the processes designs according to its volume and variety characteristics. Eventually the details of the proce ss must be analyzed to en legitimate that it fulfills its objectives effectively. The proposed model of synergies between design and process management holds true for large and small firms, for firms with different levels of TQM experience, and in different industries with varying levels of competition, logistical complexity of production, or production process characteristics.Finally, the results also suggest that organisational learning enables mature TQM firms to implement both design and process efforts more rigorously and the synergies between design and process management help these firms to attain better quality outcomes. Q5. Raising elderberry bush management awareness of operations as a significant competitive tool ( vocation Design and cognitive operation Management). 1. 0 Introduction Many senior executives entered the makeup through finance, trategy, or marketing and built their reputations on work in these areas, and as a result often take operations for granted. Th e executives have creatively used operations management for competitive advantage. Raising senior management awareness of operation as a significant competitive weapon refers to the contrast design of the senior management and the performance of the management. Theoretically, workersaremotivatedby assembly linesinwhichtheyfeeltheycanmake adifferencein their performance and the way thetasksgive areunitetofor complete vocations. egest cabledescriptionswill motivateworkforceandbe successfulin completionoftasks. It also important to have both of the employer and employee needed to share translateing of the work to be done with it and comfort with working environment. The employee and employer also need to face the challenges associated with employing a large of people in a wide variety of people in a wide of capacities. Most of the employee is assigned to do a duty because they are perceived to be able to fill its requirements. Manytasksdepending on ability time allotment and other c onstraints.The role of HR in the present scenario has undergone a sea change and its focus is on evolving such functional strategies which enable successful implementation of the major corporate strategies. In a way, HR and corporate strategies function in coalition. Today, HR works towards facilitating and upward(a) the performance of the employees by building a conducive work environment and providing maximum opportunities to the employees for participating in organizational planning and decision making process. Today, all the major activities of HR are driven towards development of high performance leaders and fostering employee motivation.So, it can be interpreted that the role of HR has evolved from merely an appraiser to a facilitator and an enabler. Performance management is the current buzzword and is the need in the current times of cut throat competition and the organizational battle for leadership. Performance management is a much broader and a complicated function of H R, as it encompasses activities such as joint determination riding horse, continuous progress review and frequent communication, feedback and coaching for modify performance, implementation of employee development programmes nd rewarding achievements. The process of performance management starts with the joining of a new incumbent in a system and ends when an employee quits the organization. Performance management can be regarded as a systematic process by which the overall performance of an organization can be improved by improving the performance of individuals within a team framework. It is a means for promoting superior performance by communicating expectations, defining roles within a required competence framework and establishing doable benchmarks.Aperformance management processsets the platform for rewarding rectitude by aligning individual employee accomplishments with the organizations mission and objectives and making the employee and the organization understand the r ichness of a specific line of business in realizing outcomes. By establishing clear performance expectations which includes results, actions and behaviours, it helps the employees in understanding what exactly is anticipate out of their jobs and setting of standards help in eliminating those jobs which are of no use any longer.Through regular feedback and coaching, it provides an advantage of diagnosing the problems at an early stage and victorious corrective actions. To conclude, performance management can be regarded as a proactive system of managing employee performance for driving the individuals and the organizations towards desired performance and results. Its about striking a harmonious alignment between individual and organizational objectives for accomplishment of excellence in performance. 2. 0 Discussion 2. 1 JOURNAL THE EFFECT OF MANAGEMENT COMMITMENT TO attend ON EMPLOYEE SERVICE BEHAVIORS THE MEDIATING ROLE OF JOB SATISFACTIONRefer on the journal the proposed model in the siamese connection hotel work setting indicates that management service initiatives, particularly study, rewards, and say-so deliver a strong subject matter to employees that the management is devoted to quality service, ultimately creating the positive affect (i. e. , employee satisfaction). Furthermore, the result showed that when employees are satisfied with their job, this positive feeling about their job motivates them to go the extra mile for customers and help co-workers and supervisors in need.Currently, not all hotel operators in Thailand favour the four management service initiatives because those options can be costly. However, it seems to be clear that management should consider allocating more resources to implement such initiatives. Among the four management service initiatives, rewards displayed the largest effect on Thai hotel workers job satisfaction, with the largest pathway coefficient. In general, two kinds of rewards are available financial and non financial rewards. Rewards also range from a simple thank-you note for an exceptional service to a large reward such as wage increase and promotion.Rewards disposed(p) to employees, regardless of the type, must be meaningful to the employees and the organization. In other words, rewards should be based on employees job performance and reflect the organizations goal and service standard. Most rewards in the Asian culture, including Thailand, are in monetary form. However, because of the growing influence of the Western style of management, rewards in the form of recognition, such as being selected as employees of the month (or the year) with a certificate, are getting popular in Thailand.This kind of recognition can increase employees morale and make workers feel that they are appreciated and valued as a member of the organization, leading to job satisfaction and organizational loyalty. Panmunin (1993) reports that Thai hotel employees suffer from low self-esteem because the Thai ca ste system disparages servants as low caste individuals. The result of the present study seems to emphasize the importance of appropriate rewards for Thai frontline hotel workers, who may be often neglected and unvalued in the caste system (high-power-distance culture), to improve their work morale.Next, this study demonstrates that schooling cannot be overlooked to satisfy hotel workers. Through learning, Thai employees master the base skills necessary to perform the daily duties of the position and develop job competence. In addition to the basic skills, more Thai hotels are offering training such as dealing with guests complaints. It is a new type of training that originates from the Western hotel companies. Typically, when Thai employees encounter disgruntled or difficult guests, they have supervisors or mangers handle the situation.This new training program broadens frontline employees responsibilities and teaches priggish techniques to figure out conflicts and deal with problems immediately to build customer satisfaction. The result of this study seems to suggest that Thai hotel personnel are satisfied with this new, extra training. Third, this study implies that empower Thai employees are satisfied and exert more positive service behaviours. This result contradicts the proposed hypothesis.Despite the vertical culture, more and more hotel organizations in Thailand are embracing the concept of empowerment by allowing frontline personnel to make more decisions to take care of in-house guests. Although empowerment is a relatively new concept for hotels in Thailand, the result indicates that line employees are quickly adopting such a work practice and are happy about it. In general, frontline employees are much younger than managers in Thai hotels. The young generation has been more exposed to the global influence of U. S. culture. Thus, young Thai hotel employees may regard a Western management practice such as empowerment highly.We also speculate t hat the positive empowerment outcome is attributed to the new additional training and the Western style of rewards. Research has shown that empowerment often involves training and rewards to be more effective. Another possible explanation regarding the positive effect of empowerment is the growing size of tourism. Thailand is one of the popular travel destinations in the world, and hotels are receiving large numbers of international customers. In Western countries, it is common to see frontline employees empowered to meet the guests needs immediately.Travelers, particularly from the United States and atomic number 63 may be accustomed to such a level of customer focus and expect Thai hotels to offer a comparable level of service. The management in Thailand is becoming aware of the phenomenon and at that placefore expending more effort to make use of empowerment to please international hotel guests. Finally, there is no significant effect of organizational support on hotel employees job satisfaction. In this study, organizational support focuses on help offered to frontline workers when necessary, appropriate job design, and support for frontline employees goals and values.This insignificant result may be partly associated with the high power distance between supervisors and subordinates. In the Thai hotel organization, managers are more likely to be valued and respected than frontline personnel, and Thai managers with authoritative leaderships are least likely to place a high priority on the well-being of frontline employees and assisting in their job. Although the organizational culture is changing slowly, and large Thai hotel companies are adopting Western management styles, it takes a long time for employee perceptions to change.Thai frontline personnel are more likely to recognize strong organizational support (i. e. , they feel they receive enough help at work, their job is designed to be rewarding, and their goals and values are as important as manager s goals and values) in the future. In the conclusion of organizational behaviour, service quality initiatives such as rewards, empowerment, training, and organizational support have been a revolving theme fasten with employee satisfaction and performance. This study presents how these initiatives work in a culturally different setting such as Thailand.The results of this study indicate that the service quality initiatives, which mostly originate from the U. S. or Western (horizontal) culture, are worthy of trial in Asian hotels (with a vertical culture) because such initiatives may help improve frontline employees morale and self-esteem and ultimately increase the overall military strength of the hotel operation. In summary, hoteliers should continue to increase decentralization of authority, develop attractive compensation, and improve frontline workers knowledge and skills through ongoing training.Then, all these efforts are likely to pay off by yielding happier, committed staff members who care about guests and other co-workers. 2. 2 ARTICLE JOURNAL SHAKING UP INTELS INSIDES Performance-based, standardized job descriptions provide employees with clear and attainable job duties and responsibilities as well as the resources needed to accomplish them (Mahdieh,2013). We work with employees to explain the tools and their importance to achievement of the organizations mission and goals a critical factor in retaining valuable staff and preventing costly burnout.Employees are an organizations most valuable resources. Companies spend considerable amounts of money and time underdeveloped and supporting their human resources. A critical component of this development and support is employee performance management. An employees performance is a measure of the ways in which their work-related behavior contributes to achievement of the organizations business objectives. In this article, they have problem in new employee, employees are now on stage when theyre meeting w ith customers and off stage when theyre in a back office handling paperwork.And he implemented an exhaustive playbook that has scripts for everything down to the language with which tellers are supposed to greet customers. Still, at one capital of Massachusetts branch McGee visited, Paul J. Hillson, a consumer marketing manager, concedes that he encountered initial resistivity from some FleetBoston tellers What you hear is, But I already know that customer. McGee agrees that changing employee behavior is understood a work in progress. . Managing this performance is the key to producing high achieving and reliable human resources.Performance management is a process by which managers and employees work together to plan, monitor and review an employees work objectives and overall contribution to the organization(Memoona,2013). More than just an annual performance review, performance management is the continuous process of setting objectives, assessing progress and providing on-going coaching and feedback to ensure that employees are meeting their objectives and career goals.In this case we can see analysts said, has been the efforts of McGee and his team to overhaul Fleets branches, from products to training to culture. To lure new customers, BofA dangled free checking and free online bill-paying, a service for which many New England banks still charged. And while the old FleetBoston simply gave customers the 800 number for an outside mortgage lender, BofA has outfitted roughly two-thirds of Fleet branches with special software that approves or rejects a customers application for a mortgage or home-equity loans within 30 minutes.As a conclusion, this is in line with results in the emotions and justice belles-lettres that negative judgements are influential drivers of employee behaviours and attitudes (Brown et al. ,2011). Performance approximations are a pedestal component of human resource management, the outcomes of appraisals are used as the unveilin g of many human recourse decisions. While organizations devote considerable resources and time into performance appraisal this collected study has demonstrated that the quality of the employee performance appraisal experience are different.There are employees with low quality performance appraisal experiences while at the other end of the scale, there are some employees who state high quality experiences of the performance appraisal process. Moreover, this research demonstrates that organizations pay a price for letting low quality performance appraisal experiences, when employees have low quality performance appraisal experiences the organization will likely to bring a penalty in forms of lower job satisfaction and higher intentions to quit. 2. 3 ARTICLE BOFAS HAPPY SURPRISEIn this world of competition as organizations effort to remain competitive and sustainable, human resources professionals and strategic planners should collaborate strongly in designing strategies which are more productive and useful (Dazel. 2103). Among these functions, one of the most critical ones that bring global success is performance appraisal . It is more considerable than other processes because its results show the success of the awareness of the other areas in the field of homo Resources and other personnel activities.In the other perspective, assumptions of corporate management show that performance appraisal makes people to be authentically engaged in the business of the organization. In this situation, the article shows hes making it clear to employees that, under his leadership, Intel truly are entering a new era. Otellini, who officially takes the helm on May 18, will be the first chief executive without an engineering degree at a company where gear heads have reigned supreme. He believes that to keep Intel growing, every idea and technical solution should be focused on meeting customers needs from the outset.So rather than relying on its engineering prowess, Intels reorg anization will bring together engineers, software writers, and marketers into five market-focused units corporate computing, the digital home, erratic computing, health care, and channel products PCs for small manufacturers. The development of an organisational culture indicator followed a review of the organisational culture literature, in which particular attention was given to the instruments that have been most commonly used in its measurement (Michael, 2013).In this article, we can see that the new regime will cause a shake up to the culture. For decades, employees have been compensated for their own work. Now teams will be judged as a whole. Engineers, long the top dogs, may resist working with others. Its like saying to a baseball player, Gee, were deciding to play pro football, says Edward E. Lawler, a professor at USCs Marshall enlighten of Business. All of a sudden, the rules of the game are very different. Otellini has begun to put the pieces in place. Now hell need t he teamwork of his people to pull it off.As conclusion, this article established that there was no existing tool which adequately met our requirements for a comprehensive, up-to-date measure, easily completed by all levels of the workforce. Through the review process we were able to identify the cultural dimensions most frequently assessed in organisations and deemed important in this extensively researched field. A parallel search of literature on current manufacturing practice highlighted other areas less traditionally examined in culture research, but which we thought relevant in capturing critical aspects of organisational culture in the manufacturing sector.Performancemanagementis a significant tool in businessmanagementtoday. Management activity of this type makes it easier to evaluate the productivity of individual employees as well as entire departments. As a result, the company will function more efficiently, may keep smash-up low, and has a better chance of succeeding. Th ere are many benefits ofperformance managementthat have a direct bearing on the casual operation, which in turn makes the overall picture for the company much brighter. internal the company of The New York quantify, there have a lot of job design and performance management that occur and be built by the employer to their employees. Many advantages can we get by doing the implementation of job design and performance management. Through the implementation of performance management, the employer can get the result for what actually their employees doing in managing their work. The use of specific metrics in a performance management program allows employer to make decisions regarding performance breakdowns.Initially, it allows employer to pinpoint problems and take the proper corrective actions to immediately rectify them. For example, as our research in year 2003, according to the journal of The New York Times, Arthur Ochs Sulzberger Jr. , the current proprietor, face up what seemed to be a publishers ultimate test after a loosely supervised young reporter named Jayson Blair was found to have fabricated dozens of stories. The crisis was emerged between the employer and its employees after the employer getting know about their employees attitude.The employer can strictly blot for whom employees that making a wrongfulness attitude and breaking the rules of their job ethics. The effects of these crisis has causes the companys performance lagging. The companies had difficult moments eventual through allegations received due to errors employees. However, it can be improved by making implementation of performance management. Performance management allows employer to make decision and focus their feedback on issues or crisis directly related to the achievement of the individual employees goals and objectives.Any other issues or crisis distracting the employee that dont contribute to the unit or departments performance can be quickly and effectively handled and elimin ated. One of the examples of performance management that can be found in the journal of The New York Times is where Keller has made so many high-level personnel changes whereby two-thirds of all newsroom workers now report to a new boss. Other than that, Keller has also put into practice a string of reforms suggested by several internal committees formed in the wake of the Blair affair.Meaning to say, these include the appointment of a standards editor and a public editor, or ombudsman. After making this system, the company performances was increase and improved and at the same time the whole of operation managements can be run smoothly. According to journal, The Times posted its gains despite boosting the price of a subscription by more than 20% on average. As a conclusion, a good performance management system works towards the improvement of the overall organizational performance by managing the performance of teams and individuals.That is for ensuring the achievement of the overa ll organizational ambitions and goals. The Times can built more an effective performance management system that can play a very crucial role in managing the performance in an organization such as ensuring the employees understand the importance of their contribution to the organizational goals and objectives. Other than that, by ensuring each employee understands what is evaluate from them and equally as pertaining whether the employee possess the required skills and support for fulfilling such expectations.Ensuring proper aligning or linking of objectives and facilitating effective communication throughout the organization and facilitating a cordial and a harmonious relationship between an individual employee and also the line employer based on trust and empowerment. 2. 4 The Effects of Job Rotation Practices on Motivation A Research on Managers in the Automotive Organizations This article is about the use of data envelopment analysis (DEA) to calculate and analyze the level of te chnical, allocate and cost efficiencies of Australian hospital food service operations.As we know, every provision of food to the patients is the indebtedness of each individual hospital. To prepare the food their must cooked and plated and serve it in hot condition, that can we call as a cook-serve system. Therefore this system required substantial labor input and always created focus arising because of the necessity of working tight schedules and need to achieve high quality standards. In 1970, the new system of foodservice was introduced which is the introduction of the hybrid and cook-chill system.These new system require large initial capital investment. There has been an essential expansion in the use of cook-chill systems throughout the different states because of the technology changes. However, the last health service report published that inefficiency is still a problem with most hospital foodservice operation because of the underutilization of production capacity. Actu ally, this is the on how performance management taking place to overcome this problem. There are a lot of the significant of making implementation of performance management.The primary reason to make sure performance management processes are functioning properly is to tighten the link between strategic organizational objectives and day-to-day actions. Effective goal setting (including timelines), combined with a method to track progress and identify obstacles, contributes to success and bottom line result. Frequently tracking progress against performance goals and objectives also provides the opportunity to recognize and reward employees for performance and exceptional effort, contributing to job satisfaction and productivity.Employees want to feel successful, to do well at their job and feel there are making a valuable contribution. In order to ensure this happens, employees need a clear understanding of individual goals and how they fit into the larger organization. New technology -based solutions offered can provide goal visibility across entire organizations, offer extensive reporting option and can reduce paperwork by as much as 90%. Clear visibility, regular individual analysis and company-wide employee appraisals help identify corporate competencies and skill gaps.With this valuable data, organizational can identify training and development plans. Performance management best practices result in a wide range of the advantages for employees, employer and whole organizational. In a nutshell, the performance management inside every organizational is one of the essential tool to gain a goal and objectives of organizations. Therefore, the organization like hospital can considered more about their performance management to overcome their problem. At the same times gain successful services to their patient. 2. ARTICLE JOURNAL THE FUTURE OF THE NEW YORK TIMES BUSINESSWEEK Human Resource is the most important resource compared with other resources like machine, m aterial, land, and so forth In the organizational context, the effectiveness of human resource depends on designing the job according to human capability and characteristics. Job design is the most important function of Human Resource Management. It indicates that, designing of contents, methods, functions of a job. The performance of an employee is that, how well an employee performs his or her task duties and responsibilities.Employees performance is also crucial. Because the achievement of goals and objectives of the organization is assessed by performance of its resources, employees performance should be assessed and maintained periodically. At work, in a human-focussed approach, the human oriented process designs have shown its importance as much as the technical issues, from a productivity aspect. Several human-focussed applications such as increasing motivation at work, improving workers physical working conditions, obtaining job security, and increasing job satisfaction, inc reasing quality nd productivity, decrease costs to become competitive are increasing its importance by the day.Within the natural development process of work, maybe humanist problems exceed technical problems and even the cost of investment in personal has gone beyond the point of technical investment. Job analysis, training, performance measurement, re-organisation projects, re-engineering studies and especially applications related to job design which support this approach have an important place among human resources applications.Job design related applications began to take precondition with a scientific management approach in the 1900s. Models related to job design able to be classified as job rotation, job enlargement, job enrichment, job engineering, quality of work life, social information process approach and job characteristics approach, have extremely important effects on increasing the productivity of human resources. It is predicted that job satisfaction and productiv ity will be highest when both job enlargement and job enrichment are together with applied to redesigning work systemsFrom a conceptual perspective, job design is defined as determining the specific job content, the methods used at work and the relationships between jobs to correspond the firms technological and organisational, and the employees social and personal expectations. In accordance with this definition, it is stated that a well-designed and defined job increase employees job satisfaction, increases motivation, decreases workplace-related stress, encourage learning efforts and is therefore have a positive effect on employees performance.There are many studies published in related literature investigating the relationship between job design and employees motivation. The common points of these studies is that the application of job design has a positive effect on the specifics of job performance, like motivation, flexibility, job satisfaction, self-control, and skill develo pment. The relevant studies are shown in Table below.